BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0917 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 26 0.24 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 6.9 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 6.9 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 6.9 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 26.2 bits (55), Expect = 0.24 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 158 IEFSKESPEGNGDMPIETVKVVGLRKVP-GQPLGLTVTTDEHGQLIV 295 I E+ G+ + P ETV ++ +VP G P + V T++ L+V Sbjct: 969 IRIVAENEIGSSE-PSETVTIITAEEVPGGPPTSIRVETNDQHSLVV 1014 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 431 PYHLVLLQLPSVAPLIQCEPR 369 PY +LQLP+V + + +P+ Sbjct: 61 PYMSSVLQLPTVTEIQETQPQ 81 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -2 Query: 171 FENSIRSGNSFGINLSSIPDP 109 F N + + +FGI ++S+ +P Sbjct: 134 FSNDVIATAAFGIRVNSVQEP 154 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 431 PYHLVLLQLPSVAPLIQCEPR 369 PY +LQLP+V + + +P+ Sbjct: 52 PYMSSVLQLPTVTEIQETQPQ 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,899 Number of Sequences: 336 Number of extensions: 3330 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -