BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0916 (779 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2EAR4 Cluster: GAF domain containing protein; n=1; Tri... 34 3.5 >UniRef50_A2EAR4 Cluster: GAF domain containing protein; n=1; Trichomonas vaginalis G3|Rep: GAF domain containing protein - Trichomonas vaginalis G3 Length = 1209 Score = 34.3 bits (75), Expect = 3.5 Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +2 Query: 473 YIFMNNDLVS-WSLP-DVLIVLVVAYARSYQNSSFHNYHKTILRLAIVFYHQMVARIFIN 646 +IF L+S +++P V + + A +YQ FH++ + F+ M+ +++I Sbjct: 939 HIFTEMGLLSTFTIPIGVALRFFSSIADNYQQLPFHDFANAVSTTQFAFWLMMLNKLYIQ 998 Query: 647 FTQLKALNF 673 FT+++ L+F Sbjct: 999 FTKIELLSF 1007 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 728,858,713 Number of Sequences: 1657284 Number of extensions: 14257504 Number of successful extensions: 30530 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 29548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30528 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65850543200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -