BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-0916
(779 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A2EAR4 Cluster: GAF domain containing protein; n=1; Tri... 34 3.5
>UniRef50_A2EAR4 Cluster: GAF domain containing protein; n=1;
Trichomonas vaginalis G3|Rep: GAF domain containing
protein - Trichomonas vaginalis G3
Length = 1209
Score = 34.3 bits (75), Expect = 3.5
Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
Frame = +2
Query: 473 YIFMNNDLVS-WSLP-DVLIVLVVAYARSYQNSSFHNYHKTILRLAIVFYHQMVARIFIN 646
+IF L+S +++P V + + A +YQ FH++ + F+ M+ +++I
Sbjct: 939 HIFTEMGLLSTFTIPIGVALRFFSSIADNYQQLPFHDFANAVSTTQFAFWLMMLNKLYIQ 998
Query: 647 FTQLKALNF 673
FT+++ L+F
Sbjct: 999 FTKIELLSF 1007
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 728,858,713
Number of Sequences: 1657284
Number of extensions: 14257504
Number of successful extensions: 30530
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 29548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30528
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 65850543200
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -