BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0916 (779 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharo... 27 2.3 SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizo... 27 4.0 SPBC16H5.03c |fub2|uba2|SUMO E1-like activator enzyme Fub2|Schiz... 26 7.0 SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 25 9.2 SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr ... 25 9.2 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 25 9.2 SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch... 25 9.2 >SPCC553.12c ||SPCC794.13|conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 27.5 bits (58), Expect = 2.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 337 YFV*WNIITFNVITQQYFRMII*I*VFFS 423 YF W ITF IT + MII I + FS Sbjct: 193 YFTAWRQITFTWITLMFISMIIPIGISFS 221 >SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizosaccharomyces pombe|chr 1|||Manual Length = 801 Score = 26.6 bits (56), Expect = 4.0 Identities = 18/65 (27%), Positives = 35/65 (53%) Frame = -1 Query: 326 VGVLTPTTSLYRAAHFPLSFHFRVSDGLSRDPIRRTGSYRRGHDPKRPTFIIQFRILTIL 147 VG++ +++++ PL F+ DG S+ PI ++ G D ++ +IQ ILT++ Sbjct: 512 VGIIPDACTVFKSTMQPLRLLFKCQDG-SKYPI----IFKNGDDLRQDQLVIQ--ILTLM 564 Query: 146 H*TIK 132 +K Sbjct: 565 DKLLK 569 >SPBC16H5.03c |fub2|uba2|SUMO E1-like activator enzyme Fub2|Schizosaccharomyces pombe|chr 2|||Manual Length = 628 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 539 QRPTRLRHLATTTKPNHY 486 +RPTR+ H T KPN Y Sbjct: 412 KRPTRVLHCEKTCKPNPY 429 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -1 Query: 236 DPIRRTGSYRRGHDPKRPTFIIQFRIL 156 D +RR Y G++P PT ++ + +L Sbjct: 920 DDLRRHTVYAGGYEPNSPTIVLFWEVL 946 >SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1237 Score = 25.4 bits (53), Expect = 9.2 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = +2 Query: 488 NDLVSWSLPDVLIVLVVAYARS----YQNSSF 571 ++L SW+L +VLI+ +V Y S Q SSF Sbjct: 24 DELYSWTLKNVLILFLVQYRASTPSALQTSSF 55 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 25.4 bits (53), Expect = 9.2 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 473 YIFMNNDLVSWSLPDVLIVLVVAYARSYQNSSFHNYHKTI 592 YI NN + S D LI+L + YQ H YH I Sbjct: 1280 YIESNNSAMHIS--DCLILLHEFLVQGYQGVDMHTYHNII 1317 >SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1133 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 250 TDCRAILYDELAATGADTTRNDRPSLF 170 +D AILYD++ +GA+ +PS F Sbjct: 415 SDQLAILYDKVKTSGAELPSAPKPSTF 441 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,139,611 Number of Sequences: 5004 Number of extensions: 63913 Number of successful extensions: 151 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -