BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0915 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 3.7 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 4.8 AY752909-1|AAV30083.1| 92|Anopheles gambiae peroxidase 14 prot... 23 6.4 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.2 bits (50), Expect = 3.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 111 HYCFTAEIGRVVVPTRADSQEVLPPVKN 194 H F AEIG +V DS E+LP N Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPAN 966 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 9 TRLQRKYANHLEI*VLRYLRRYK 77 T + +KY NHL+ + RR+K Sbjct: 724 THVSQKYRNHLQKKAAEWFRRHK 746 >AY752909-1|AAV30083.1| 92|Anopheles gambiae peroxidase 14 protein. Length = 92 Score = 23.4 bits (48), Expect = 6.4 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +3 Query: 39 LEI*VLRYLRRYKSNVCPTLQSEMHYCFTAEIGRVVVPTRADSQEVLPPVKNE 197 LE+ Y R Y +NV PT+ +E + + P + PPV E Sbjct: 8 LELETSGYYRNYDANVNPTVANEFS-AAALPVRPLAHPEHVHAGGSAPPVHRE 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,419 Number of Sequences: 2352 Number of extensions: 12626 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -