BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0915 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88173-7|AAK21383.2| 361|Caenorhabditis elegans Hypothetical pr... 33 0.23 AF038608-12|AAY86214.1| 132|Caenorhabditis elegans Hypothetical... 30 1.6 Z74043-11|CAA98549.3| 303|Caenorhabditis elegans Hypothetical p... 28 5.0 AC084197-15|AAN63425.1| 391|Caenorhabditis elegans Hypothetical... 28 6.7 AC084197-14|AAM44396.1| 526|Caenorhabditis elegans Hypothetical... 28 6.7 AC084197-13|AAM44395.1| 571|Caenorhabditis elegans Hypothetical... 28 6.7 Z75547-11|CAA99905.4| 394|Caenorhabditis elegans Hypothetical p... 27 8.8 >U88173-7|AAK21383.2| 361|Caenorhabditis elegans Hypothetical protein F46F11.6 protein. Length = 361 Score = 32.7 bits (71), Expect = 0.23 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Frame = +2 Query: 83 RLPHPSKRNALLLHGRNRQGCGTYP-----CGLTRGPTTSK 190 RLP P K+N +L+ N Q C T P G+T P+T+K Sbjct: 30 RLPFPDKQNMMLVSWENSQICSTLPNKLHELGITELPSTAK 70 >AF038608-12|AAY86214.1| 132|Caenorhabditis elegans Hypothetical protein C09G12.17 protein. Length = 132 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 269 PVGGLSESRLD-CAANISPQCNPPNQNQLAS*NTMIRDQVT 388 PVG ++ + + C S CNPP+ N A+ + M +DQ++ Sbjct: 54 PVGSVTTADSNGCPTVYSITCNPPDTNPTATVSMMFQDQIS 94 >Z74043-11|CAA98549.3| 303|Caenorhabditis elegans Hypothetical protein T19B10.10 protein. Length = 303 Score = 28.3 bits (60), Expect = 5.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 579 PIHYRGTITCVSNKIKICNH 638 P HY T+TC+++ + +C H Sbjct: 42 PCHYLITLTCIADMLHLCGH 61 >AC084197-15|AAN63425.1| 391|Caenorhabditis elegans Hypothetical protein Y73B6BL.5c protein. Length = 391 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 297 RRDSDSPPTGKPGFSVTDNYRS 232 RR SPP G+PG V +YR+ Sbjct: 368 RRRRPSPPRGRPGEKVVQSYRN 389 >AC084197-14|AAM44396.1| 526|Caenorhabditis elegans Hypothetical protein Y73B6BL.5b protein. Length = 526 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 297 RRDSDSPPTGKPGFSVTDNYRS 232 RR SPP G+PG V +YR+ Sbjct: 503 RRRRPSPPRGRPGEKVVQSYRN 524 >AC084197-13|AAM44395.1| 571|Caenorhabditis elegans Hypothetical protein Y73B6BL.5a protein. Length = 571 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 297 RRDSDSPPTGKPGFSVTDNYRS 232 RR SPP G+PG V +YR+ Sbjct: 548 RRRRPSPPRGRPGEKVVQSYRN 569 >Z75547-11|CAA99905.4| 394|Caenorhabditis elegans Hypothetical protein R11D1.10a protein. Length = 394 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 257 KPGFPVGGLSESRLDCAANISPQCNP 334 KP +P L + RL +ISPQ P Sbjct: 128 KPNYPTNDLEQRRLKLREDISPQIEP 153 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,573,520 Number of Sequences: 27780 Number of extensions: 286687 Number of successful extensions: 520 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -