BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0913 (529 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22X13 Cluster: Putative uncharacterized protein; n=1; ... 32 7.1 UniRef50_UPI00006CD145 Cluster: hypothetical protein TTHERM_0012... 32 9.4 >UniRef50_Q22X13 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 316 Score = 32.3 bits (70), Expect = 7.1 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -2 Query: 498 N*LYSNMLRSKILVPTY-----FIYITLCLYSV*NYSSR*NESILIEFNSDLRF 352 N YS++ R+K+L+P Y F TL + S ++ S N+S++I D+RF Sbjct: 258 NPFYSHIFRNKVLIPMYNRDALFNLFTLVIASTHSHISSINQSLIIINLKDIRF 311 >UniRef50_UPI00006CD145 Cluster: hypothetical protein TTHERM_00127160; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00127160 - Tetrahymena thermophila SB210 Length = 162 Score = 31.9 bits (69), Expect = 9.4 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 50 RVQCTQLVTNMKEICVCDLLGTEFPKGRLSQASLSVCLNYLFTYIICNIYM 202 +V T+L+ +KE+ VC + + S + NYL+ +I+ NIYM Sbjct: 49 KVLATKLIKCLKELAVCSKSALKENLENIGSISADI-KNYLYEHILSNIYM 98 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 446,908,547 Number of Sequences: 1657284 Number of extensions: 7853194 Number of successful extensions: 15434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15420 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 33455602480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -