BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0913 (529 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CU457744-2|CAM36368.1| 169|Caenorhabditis elegans Hypothetical ... 27 8.3 AF016451-10|AAB66006.2| 259|Caenorhabditis elegans Hypothetical... 27 8.3 >CU457744-2|CAM36368.1| 169|Caenorhabditis elegans Hypothetical protein T06A10.3 protein. Length = 169 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 290 LKFKRCFEN*YYNLQHIIYKKHIKYHE*VTCK 195 LK KRC YN++H + ++ +++HE + CK Sbjct: 53 LKLKRCS----YNMRHFLPEEELQFHE-IFCK 79 >AF016451-10|AAB66006.2| 259|Caenorhabditis elegans Hypothetical protein C03A7.12 protein. Length = 259 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +3 Query: 42 IYHVYSVRSLLRI*KKY-VYAICWELNF-PREDFL 140 +Y Y+VR+ +++ KKY YA W+ N P E+ L Sbjct: 84 VYPRYAVRNFVKVFKKYPEYAFLWKYNVQPGEEKL 118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,892,211 Number of Sequences: 27780 Number of extensions: 208310 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -