BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0910 (466 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY095068-1|AAM11396.1| 110|Drosophila melanogaster RE14985p pro... 48 6e-06 AE014296-608|AAF47744.1| 110|Drosophila melanogaster CG17737-PA... 48 6e-06 U01182-1|AAC03566.1| 1256|Drosophila melanogaster flightless-I p... 30 1.8 AF132184-1|AAD34772.1| 1256|Drosophila melanogaster unknown prot... 30 1.8 AF017777-2|AAC28407.1| 1256|Drosophila melanogaster flightless p... 30 1.8 AE014298-3118|AAF50830.2| 1256|Drosophila melanogaster CG1484-PA... 30 1.8 AY070935-1|AAL48557.1| 255|Drosophila melanogaster RE03306p pro... 28 5.4 AY060271-1|AAL25310.1| 263|Drosophila melanogaster GH10494p pro... 28 5.4 AE014296-536|AAF47705.1| 263|Drosophila melanogaster CG1893-PA ... 28 5.4 BT025206-1|ABF17897.1| 624|Drosophila melanogaster FI01110p pro... 27 9.4 BT023401-1|AAY55817.1| 624|Drosophila melanogaster IP01633p pro... 27 9.4 AE013599-2011|AAF58170.2| 624|Drosophila melanogaster CG8089-PA... 27 9.4 >AY095068-1|AAM11396.1| 110|Drosophila melanogaster RE14985p protein. Length = 110 Score = 48.0 bits (109), Expect = 6e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 1 NICQWLTKSGLVKPEQLKVHGF 66 NICQWLTK GL KP+QLKVHGF Sbjct: 89 NICQWLTKVGLAKPDQLKVHGF 110 >AE014296-608|AAF47744.1| 110|Drosophila melanogaster CG17737-PA protein. Length = 110 Score = 48.0 bits (109), Expect = 6e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 1 NICQWLTKSGLVKPEQLKVHGF 66 NICQWLTK GL KP+QLKVHGF Sbjct: 89 NICQWLTKVGLAKPDQLKVHGF 110 >U01182-1|AAC03566.1| 1256|Drosophila melanogaster flightless-I protein. Length = 1256 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 293 NNQSNEIVNIPNSLFLFLYDIVFLNCCNNSI 385 N +N+I +IP LF+ L D++FL+ +N + Sbjct: 129 NLSNNQIESIPTPLFIHLTDLLFLDLSHNRL 159 >AF132184-1|AAD34772.1| 1256|Drosophila melanogaster unknown protein. Length = 1256 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 293 NNQSNEIVNIPNSLFLFLYDIVFLNCCNNSI 385 N +N+I +IP LF+ L D++FL+ +N + Sbjct: 129 NLSNNQIESIPTPLFIHLTDLLFLDLSHNRL 159 >AF017777-2|AAC28407.1| 1256|Drosophila melanogaster flightless protein. Length = 1256 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 293 NNQSNEIVNIPNSLFLFLYDIVFLNCCNNSI 385 N +N+I +IP LF+ L D++FL+ +N + Sbjct: 129 NLSNNQIESIPTPLFIHLTDLLFLDLSHNRL 159 >AE014298-3118|AAF50830.2| 1256|Drosophila melanogaster CG1484-PA protein. Length = 1256 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 293 NNQSNEIVNIPNSLFLFLYDIVFLNCCNNSI 385 N +N+I +IP LF+ L D++FL+ +N + Sbjct: 129 NLSNNQIESIPTPLFIHLTDLLFLDLSHNRL 159 >AY070935-1|AAL48557.1| 255|Drosophila melanogaster RE03306p protein. Length = 255 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 207 RPVPCDFLCCIKYCKS--YILSPPSRLI 284 RP CD LCC C + + +PP ++I Sbjct: 133 RPFKCDILCCFPSCMNAVEVSAPPGQVI 160 >AY060271-1|AAL25310.1| 263|Drosophila melanogaster GH10494p protein. Length = 263 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 207 RPVPCDFLCCIKYCKS--YILSPPSRLI 284 RP CD LCC C + + +PP ++I Sbjct: 133 RPFKCDILCCFPSCMNAVEVSAPPGQVI 160 >AE014296-536|AAF47705.1| 263|Drosophila melanogaster CG1893-PA protein. Length = 263 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 207 RPVPCDFLCCIKYCKS--YILSPPSRLI 284 RP CD LCC C + + +PP ++I Sbjct: 133 RPFKCDILCCFPSCMNAVEVSAPPGQVI 160 >BT025206-1|ABF17897.1| 624|Drosophila melanogaster FI01110p protein. Length = 624 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 177 STEKREHGCPRPVPCDFLCCIKYCKSYI 260 S +K+ +GCP C CC + + Y+ Sbjct: 22 SIDKKPYGCPASCHCKCKCCRGFREKYV 49 >BT023401-1|AAY55817.1| 624|Drosophila melanogaster IP01633p protein. Length = 624 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 177 STEKREHGCPRPVPCDFLCCIKYCKSYI 260 S +K+ +GCP C CC + + Y+ Sbjct: 22 SIDKKPYGCPASCHCKCKCCRGFREKYV 49 >AE013599-2011|AAF58170.2| 624|Drosophila melanogaster CG8089-PA protein. Length = 624 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 177 STEKREHGCPRPVPCDFLCCIKYCKSYI 260 S +K+ +GCP C CC + + Y+ Sbjct: 22 SIDKKPYGCPASCHCKCKCCRGFREKYV 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,862,703 Number of Sequences: 53049 Number of extensions: 361998 Number of successful extensions: 604 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1559812275 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -