BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0909 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0542 + 16940464-16940527,16941906-16942101,16942204-169423... 29 3.8 06_03_0394 - 20342756-20343310,20343400-20343591,20343689-20343925 28 6.6 06_03_0393 - 20328268-20328363,20328637-20329158,20329236-203294... 28 8.7 04_03_0111 - 11361954-11363510 28 8.7 >04_03_0542 + 16940464-16940527,16941906-16942101,16942204-16942365, 16942721-16942802,16942873-16943139,16943285-16943416 Length = 300 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = -2 Query: 212 VFIFIFKDSVAKILLLIGNSHHNKQEYFFISTNVTDAHRNNNKSCICSDSMF 57 +F I D V ++ NSH NKQ + +VT AH+N + + +SM+ Sbjct: 165 IFDLIPGDMVISAMMAAINSHWNKQAQ--VIYHVTSAHQNPIQLSLIEESMY 214 >06_03_0394 - 20342756-20343310,20343400-20343591,20343689-20343925 Length = 327 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 431 QPRVGLSLVQYISPDCFVQG--FLLLVPDTL 345 +PR+G S+++ DCFV G +L+ DTL Sbjct: 61 EPRMGASIIRLFFHDCFVNGCDASILLDDTL 91 >06_03_0393 - 20328268-20328363,20328637-20329158,20329236-20329427, 20329533-20329745 Length = 340 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -2 Query: 431 QPRVGLSLVQYISPDCFVQG--FLLLVPDTLN 342 +PR+G S+++ DCFV G +L+ DT N Sbjct: 53 EPRMGASILRMFFHDCFVNGCDASILLDDTAN 84 >04_03_0111 - 11361954-11363510 Length = 518 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 247 PLIGNLANGVFSFEWLPK 300 P GN ANG FS EWLP+ Sbjct: 327 PPAGNDANGEFSPEWLPE 344 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,070,906 Number of Sequences: 37544 Number of extensions: 291632 Number of successful extensions: 543 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -