BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0909 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.0 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 320 NSPFKHKCLRCQELEGESPEQSSLERYTGPG 412 +SP H + Q+L+ E P L++YT PG Sbjct: 157 HSPEAHISV-AQKLQKEIPNSIILDQYTNPG 186 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 661 VTAITDTHXRLNHSSTN 711 + ++D H +L H+STN Sbjct: 295 ILCMSDLHWQLPHNSTN 311 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,002 Number of Sequences: 438 Number of extensions: 3781 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -