BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0905 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 26 0.18 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 2.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 9.1 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 20 9.1 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 25.8 bits (54), Expect = 0.18 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 64 AVHQFVENTWLPSN*RTITKNQQQLKFQINRITH 165 A H + +P + RT+TK + K Q +R TH Sbjct: 20 AEHGYASTMPMPDDMRTVTKRPKTKKSQGSRTTH 53 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 2.2 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -2 Query: 125 FFVIVR*LDGSQVFSTNWCTAYQNI 51 F I L+ +F+T+WC ++++ Sbjct: 101 FSAIYEVLENRWLFTTDWCDVWRSL 125 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -1 Query: 246 LCLIIVFLLNYTTSEFVCAIR 184 LC ++ F L ++ VC I+ Sbjct: 704 LCYLVTFALVLRPTDIVCGIQ 724 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -2 Query: 173 FYKWVIRLI*NFSCCWF 123 FY + +I + CCW+ Sbjct: 475 FYDGIRDMIGYYPCCWW 491 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -2 Query: 173 FYKWVIRLI*NFSCCWF 123 FY + +I + CCW+ Sbjct: 528 FYDGIRDMIGYYPCCWW 544 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 105 LTHYNEKPTTTEVSNQSDN 161 L+ YN+KP N +N Sbjct: 151 LSDYNDKPIPASCCNSPEN 169 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,838 Number of Sequences: 438 Number of extensions: 2316 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -