BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0903 (548 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0WWS3 Cluster: Putative uncharacterized protein; n=1; ... 35 1.4 UniRef50_UPI0000D5755E Cluster: PREDICTED: similar to ribosomal ... 33 5.8 >UniRef50_Q0WWS3 Cluster: Putative uncharacterized protein; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein - Arabidopsis thaliana (Mouse-ear cress) Length = 80 Score = 34.7 bits (76), Expect = 1.4 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 33 MKNAVNCAS*CELQDTFEHRHFERTLR 113 MKN C + CELQ+ HR FER LR Sbjct: 1 MKNVAKCDTWCELQNPVNHRVFERKLR 27 >UniRef50_UPI0000D5755E Cluster: PREDICTED: similar to ribosomal protein S6 kinase, 90kDa, polypeptide 5 isoform a; n=2; Endopterygota|Rep: PREDICTED: similar to ribosomal protein S6 kinase, 90kDa, polypeptide 5 isoform a - Tribolium castaneum Length = 928 Score = 32.7 bits (71), Expect = 5.8 Identities = 22/76 (28%), Positives = 40/76 (52%) Frame = -2 Query: 502 SSILNND*YNVNNRITKPRRQKFIYTRTRYAHAKHNARAREVRRDYENFEITIKHF*IRR 323 S I+ +D +V+ ++ +RQK +Y +TR++ + +E+ D + +KH R+ Sbjct: 840 SGIVMSDKNSVDTKVVGRKRQKKVYVQTRWSERIRRRQRQEIDLD----PVPVKHNRKRK 895 Query: 322 RDELAKRDS*S*SSVR 275 DE +S S SS R Sbjct: 896 VDERESIESTSSSSKR 911 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,300,925 Number of Sequences: 1657284 Number of extensions: 8678510 Number of successful extensions: 20067 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20063 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35822246242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -