BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0899 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 30 2.2 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 3.8 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) 28 6.6 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 4e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +2 Query: 14 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 184 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 185 --AELNYAMDVYELNRRVN 235 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 48.8 bits (111), Expect = 4e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +2 Query: 17 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 193 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 194 NYAMDVYELNRRVNSSESIVGWW 262 NY M+V R VN VGW+ Sbjct: 78 NYQMEVMRRLRAVNIDHLHVGWY 100 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 34.7 bits (76), Expect = 0.076 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 395 CVPLGVPNGKQGCMFTPVDVTLTCYEPEIVGLQVCQKT 508 CV +GVP +G MF+ + + PE VG+ V Q+T Sbjct: 27 CVKMGVPGKTEGTMFSQIPCEVKLTGPEKVGVDVLQRT 64 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 179 VEAELNYAMDVYELNRRVNSSESIVG 256 V EL YA +YEL+++ N +E IVG Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVG 26 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 10 Y*CKGPSCCFISNCGRIRTSKCRF 81 Y C+G + CFI R R KCRF Sbjct: 76 YTCRGSNDCFIDKVHRNRCQKCRF 99 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -2 Query: 248 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 69 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 68 DVRMRPQFEIK 36 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 248 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 69 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 68 D-VRMRP 51 +R RP Sbjct: 147 GRLRRRP 153 >SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) Length = 270 Score = 28.3 bits (60), Expect = 6.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 343 YSGHFTGWRSNGFTCICL 396 ++GH W SNG TC+ L Sbjct: 201 FNGHTYSWHSNGVTCVLL 218 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 334 CPCYSGHFTGWRSNGFTCIC 393 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 334 CPCYSGHFTGWRSNGFTCIC 393 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,407,444 Number of Sequences: 59808 Number of extensions: 433187 Number of successful extensions: 1514 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1512 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -