BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0898 (509 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 40 0.033 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 36 0.40 UniRef50_Q5A6K9 Cluster: Putative uncharacterized protein; n=1; ... 32 6.6 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 39.9 bits (89), Expect = 0.033 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -1 Query: 218 Q*ARFRSSGRFCEAILLLGLVL 153 Q +RFRS GRFCEA+LLLGLVL Sbjct: 83 QSSRFRSDGRFCEALLLLGLVL 104 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 36.3 bits (80), Expect = 0.40 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 465 PRGGARYPIRPIVSR 509 PRGGARYPIRPIVSR Sbjct: 259 PRGGARYPIRPIVSR 273 >UniRef50_Q5A6K9 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 131 Score = 32.3 bits (70), Expect = 6.6 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 5/74 (6%) Frame = -3 Query: 435 IRIIKLFRFYSVCISASY*YF--LVAHLSLVDQFLIFLR*SF--LKG-SFVPFRPPF*TV 271 IRI+ + Y + +S Y +F L+A SL FL FL F LK S +P+ PPF Sbjct: 20 IRILIIHTLYKILVSLDYYFFFFLLAFDSLGSAFL-FLSSVFTTLKNPSSLPWTPPFNPF 78 Query: 270 YGTDSPLSFSPDLS 229 + +PLS L+ Sbjct: 79 FSFSAPLSILSSLN 92 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,055,042 Number of Sequences: 1657284 Number of extensions: 7117776 Number of successful extensions: 14544 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14543 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30946432294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -