BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0898 (509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 4.5 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 7.9 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 320 PFSR-ARSCLLGRLFELSMELIAH*VSRRI 234 PFS +R+C+ GR LSM+++ + RR+ Sbjct: 202 PFSAGSRNCIGGRYAMLSMKVMLSSILRRL 231 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 244 ETQWAISSIDSSKRRPKRHERALEK 318 E +WA ++DS ++ K+ + A+E+ Sbjct: 40 EEKWAEKAVDSLVKKLKKRKGAIEE 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 419,023 Number of Sequences: 2352 Number of extensions: 6826 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -