BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0895 (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 31 0.014 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 25 0.52 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 25 0.52 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 6.4 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 8.4 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.4 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.4 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 30.7 bits (66), Expect = 0.014 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = -3 Query: 411 FSMRSLPLSVRMMCRLGSRF-LERYATSLCQSCSSTKVRSARVSGGSAAPECSKRTLSTC 235 F RS+ + C+ G+ ++ Y CQ C K S + PEC + Sbjct: 211 FFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMR-----PECVVPEVQCA 265 Query: 234 LGRREARLARRKDSSSASTS 175 + R+E + + KD +++T+ Sbjct: 266 VKRKEKKAQKEKDKPNSTTN 285 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 345 SPRTCCPSDTSCAPRGAGTSSKNSPGPRSC 434 +P+T P++ S +P+ TSS NS P++C Sbjct: 150 TPKTS-PNEASMSPQS--TSSNNSASPKAC 176 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 345 SPRTCCPSDTSCAPRGAGTSSKNSPGPRSC 434 +P+T P++ S +P+ TSS NS P++C Sbjct: 170 TPKTS-PNEASMSPQS--TSSNNSASPKAC 196 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 373 VSLGQQVLGEVRHELVPVLQQHEGP 299 +S+ QQ+L E + L+P+ E P Sbjct: 19 LSIPQQILNEFKSTLLPLFGLKEQP 43 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 404 IEKL-TRAKELLRVKSDEAIEKCEKNAFEKK 493 +EKL T KEL + E +++ + N EK+ Sbjct: 51 VEKLLTEQKELAEKEEAETLKRYKLNDLEKR 81 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 404 IEKL-TRAKELLRVKSDEAIEKCEKNAFEKK 493 +EKL T KEL + E +++ + N EK+ Sbjct: 211 VEKLLTEQKELAEKEEAETLKRYKLNDLEKR 241 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 404 IEKL-TRAKELLRVKSDEAIEKCEKNAFEKK 493 +EKL T KEL + E +++ + N EK+ Sbjct: 211 VEKLLTEQKELAEKEEAETLKRYKLNDLEKR 241 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,152 Number of Sequences: 336 Number of extensions: 3272 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -