BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0894 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces po... 29 0.49 SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p... 27 3.5 SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ... 26 4.6 SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit ... 25 8.0 >SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 29.5 bits (63), Expect = 0.49 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -3 Query: 183 HICVLYLCKQGSRLSFSEQLTNYLTKLTNIVLDNSLDKFLL 61 HI +LY + G+ +E L LT++ VL NS+D F L Sbjct: 5 HIYILYGSETGTAEGLAESLFRSLTRMGYDVLVNSMDDFNL 45 >SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces pombe|chr 3|||Manual Length = 647 Score = 26.6 bits (56), Expect = 3.5 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -3 Query: 411 ETWLTDGILDSELFNEHYTVWRRDRNSDLTGQSRGGGVLIATRKDLKVSLQPSFNSSVE 235 +T L DS L N ++R D+TG +R L + K +L S +S+E Sbjct: 223 DTHLGGEDFDSRLVNHFIQEFKRKNKKDITGNARAVRRLRTACERAKRTLSSSAQASIE 281 >SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 26.2 bits (55), Expect = 4.6 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -3 Query: 411 ETWLTDGILDSELFNEHYTVWRRDRNSDLTGQSRGGGVLIATRKDLKVSLQPSFNSSVE 235 +T L DS L N ++R D+TG +R L + K +L S +S+E Sbjct: 223 DTHLGGEDFDSRLVNHFAQEFKRKNKKDITGNARAVRRLRTACERAKRTLSSSAQASIE 281 >SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit Pmc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 879 Score = 25.4 bits (53), Expect = 8.0 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -3 Query: 510 IHIYYQNVRGLRTKVLEFSRNLLLCSYDVIILTETWLTDGILDSELFNEH 361 IHI+ N + + S C YD +L W DGI++ ++H Sbjct: 328 IHIFV-NTQPISAFERTLSSKRSSCEYDHFLLLVEWHHDGIVEHVPLDDH 376 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,755,775 Number of Sequences: 5004 Number of extensions: 55437 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -