BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0894 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17740.1 68418.m02080 AAA-type ATPase family protein h-bcs1, ... 30 1.3 At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 30 1.7 At5g27940.1 68418.m03362 MFP1 attachment factor, putative simila... 29 4.0 At4g16570.1 68417.m02508 protein arginine N-methyltransferase-re... 29 4.0 At5g62020.1 68418.m07785 heat shock factor protein, putative (HS... 28 6.9 At5g45720.1 68418.m05621 hypothetical protein 27 9.2 At4g19980.1 68417.m02925 expressed protein ; expression support... 27 9.2 At3g26810.1 68416.m03354 transport inhibitor response protein, p... 27 9.2 At1g16670.1 68414.m01996 protein kinase family protein contains ... 27 9.2 >At5g17740.1 68418.m02080 AAA-type ATPase family protein h-bcs1, Homo sapiens, EMBL:AF026849 h-bcs1, Homo sapiens, EMBL:AF026849 h-bcs1, Homo sapiens, EMBL:AF026849 contains Pfam profile: ATPase family PF00004 gene_id:K17E7.100 contains Pfam profile: ATPase family PF00004 Length = 533 Score = 30.3 bits (65), Expect = 1.3 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 16/160 (10%) Frame = -3 Query: 480 LRTKVLEFSRNLLLCSYDVIILTETWLTDGILDSELFNEHYTVWR---RDRNSDLT---G 319 L TK+ S L++ + +L+DG + S+++N WR R++N+ + G Sbjct: 82 LSTKISPNSVRLIMARDPAEKKVKLYLSDGEVVSDVYNGIKLKWRFLARNKNNTMVEEYG 141 Query: 318 QSRGGGVLIATRKDLKVSLQPSFNSSVEDLWVTLI------VELKRETIKLHICVLYLCK 157 QS G + R+ L++S V + ++ + V KR +K+H C ++ + Sbjct: 142 QSYQGNI---QRESLELSFDKKHRDLVVNSYIPYVESKAKEVNNKRRILKMH-CYSHMAQ 197 Query: 156 QGSRLSFSEQLTNYLTKLTNIVLDNS----LDKFLLVGDF 49 ++F T + T N L S LD+F+ DF Sbjct: 198 TWQSVNFKHPST-FDTMAMNDDLKRSMIEDLDRFVGRKDF 236 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 128 CSEKDN-LEPCLHKYNTHICSLIVSRFNSTMSVTHKSSTD 244 C E D + PCL N+ + SL +SRF+S S K +++ Sbjct: 473 CGEADGKVSPCLTNRNSGLKSLWISRFSSKGSFPQKKASE 512 >At5g27940.1 68418.m03362 MFP1 attachment factor, putative similar to MFP1 attachment factor 1 [Glycine max] gi|7546729|gb|AAF63659 similar to MFP1 attachment factor 1 [Glycine max] gi|7546729|gb|AAF63659 Length = 157 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 348 RRDRNSDLTGQSRGGGVLIATRKDLKVSLQPSFNSSVEDLWVTLIVELKRETIK 187 R D S++T + + GG+L + + S NS ++ L I+ K TIK Sbjct: 33 RSDATSEVTKEEKSGGILFSVWPPCQKSRDYVVNSMIKTLSTDSILSYKYGTIK 86 >At4g16570.1 68417.m02508 protein arginine N-methyltransferase-related contains weak similarity to protein arginine N-methyltransferase 2 (EC 2.1.1.-) (Swiss-Prot:P55345) [Homo sapiens] Length = 724 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 158 LHKYNTHICSLIVSRFNSTMSVTHKSSTDELNDG-CKLTFKSLRVAI 295 +H + +H C+ I+ T S+TH+ + L+ G LT RVAI Sbjct: 372 VHLHASHTCTNILYNLKKTQSLTHERTHFPLSTGDLHLTLPPERVAI 418 >At5g62020.1 68418.m07785 heat shock factor protein, putative (HSF6) / heat shock transcription factor, putative (HTSF6) identical to heat shock transcription factor 6 (HSF6) SP: Q9SCW4 from [Arabidopsis thaliana] ;contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 299 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 123 TNYLTKLTNIVLDNSLDKFLLVGDFNLSGITWLPSN 16 T +LTK N+V D+S+D + + S I W P++ Sbjct: 22 TPFLTKTFNLVEDSSIDDVISWNEDGSSFIVWNPTD 57 >At5g45720.1 68418.m05621 hypothetical protein Length = 900 Score = 27.5 bits (58), Expect = 9.2 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 6/98 (6%) Frame = -3 Query: 408 TWLTDGIL----DSELFNEHYTVWRRDRN-SDLTGQSRGGGVLIATRKD-LKVSLQPSFN 247 TWLT +L D + H + N + LT V+ TR+D K Sbjct: 679 TWLTAALLQLAPDKQYLLPHSSSADASFNHTPLTDSDPSNHVVAGTRRDDSKQGFSCKNR 738 Query: 246 SSVEDLWVTLIVELKRETIKLHICVLYLCKQGSRLSFS 133 SVED+W+ +I E ++++ +L K+G S S Sbjct: 739 PSVEDIWLAVI-----ENVRVNGLREFLYKEGKIFSIS 771 >At4g19980.1 68417.m02925 expressed protein ; expression supported by MPSS Length = 127 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 301 TATPRLTRKVTVPIPTPNC 357 T +T+K VP PTPNC Sbjct: 13 TTATAVTKKSNVPTPTPNC 31 >At3g26810.1 68416.m03354 transport inhibitor response protein, putative E3 ubiquitin ligase SCF complex F-box subunit; similar to transport inhibitor response 1 GI:2352492 from [Arabidopsis thaliana] Length = 575 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 602 NRVQFRVCVSKVTKPDFVTS 661 N ++FR+C+ + KPD VTS Sbjct: 393 NFIRFRLCILEPNKPDHVTS 412 >At1g16670.1 68414.m01996 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like serine/threonine kinase GI:2465923 from [Arabidopsis thaliana] Length = 390 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 120 NYLTKLTNIVLDNSLDKFLLVGDFNLSGI 34 N+ + N + +NSLDK LL G + SGI Sbjct: 108 NHRILVYNFLENNSLDKTLLAGGYTRSGI 136 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,813,209 Number of Sequences: 28952 Number of extensions: 266107 Number of successful extensions: 625 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -