BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0893 (646 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.71 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.0 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 5.0 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 8.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 188 NLVEPHCLQSHTQGPVRYIYMCRCSSSREGRLNSQ 84 NLV +C ++ +R ++ CRC + L Q Sbjct: 156 NLVYVYCCDNNFNVFLRQVFTCRCKDYKNEDLEDQ 190 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 516 FLIRPGTILSVCKNVC 563 F RPGT+ N+C Sbjct: 502 FACRPGTVFHTQSNIC 517 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -1 Query: 304 LYICMYVYVYMCTLDRHNTFKTRRWKHK 221 LY C + + + L R+ K + W+++ Sbjct: 145 LYNCFHSTLLLMILSRYQRLKAQLWQNR 172 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 131 YMCRCSSSREGRLNSQT 81 +MCRC EG SQ+ Sbjct: 166 FMCRCPPDWEGTTLSQS 182 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 207 VIYIDLCFQRRVLNV 251 + Y+D FQRRV + Sbjct: 1387 IFYLDEAFQRRVTQI 1401 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 207 VIYIDLCFQRRVLNV 251 + Y+D FQRRV + Sbjct: 1387 IFYLDEAFQRRVTQI 1401 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,300 Number of Sequences: 336 Number of extensions: 3251 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -