BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0893 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.36 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.36 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 22 5.8 AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. 21 7.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 7.7 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.8 bits (54), Expect = 0.36 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = -1 Query: 142 SDIYICVGVRLPGRDASTVKHFIVIEASPPEYRETSSYIQRELS 11 S Y C L GRD V+ + PP ET+ R ++ Sbjct: 882 SGAYFCQASNLYGRDQQLVQLLVQEPPQPPNSLETAMVASRSIN 925 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.8 bits (54), Expect = 0.36 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = -1 Query: 142 SDIYICVGVRLPGRDASTVKHFIVIEASPPEYRETSSYIQRELS 11 S Y C L GRD V+ + PP ET+ R ++ Sbjct: 878 SGAYFCQASNLYGRDQQLVQLLVQEPPQPPNSLETAMVASRSIN 921 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.8 bits (44), Expect = 5.8 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +1 Query: 148 PCVCDCKQCGST 183 PC C C++C T Sbjct: 1 PCYCTCEKCKIT 12 >AY352277-2|AAQ67419.1| 88|Apis mellifera EX4.8-5.8 protein. Length = 88 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 499 NWIYYCFSYAPERS 540 NWI+ S+ PE+S Sbjct: 67 NWIHVDISFLPEKS 80 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +1 Query: 148 PCVCDCKQCGSTRFVC 195 P C+CK C S C Sbjct: 432 PIGCECKTCNSKTKCC 447 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,843 Number of Sequences: 438 Number of extensions: 3841 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -