BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0890 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0019 + 11931519-11932310 28 6.0 01_07_0242 + 42234217-42234320,42234708-42235029,42235377-422357... 28 8.0 >10_07_0019 + 11931519-11932310 Length = 263 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 356 RCKRWVCRSSPI*RG 312 RC+RW CRS P RG Sbjct: 39 RCRRWWCRSEPTSRG 53 >01_07_0242 + 42234217-42234320,42234708-42235029,42235377-42235778, 42235921-42236265,42236785-42236854,42237098-42237173, 42237309-42237459 Length = 489 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 173 HEVIRIV-EPSYVGMNNEYRISLAKKGGGCPIMNIHSE 283 HE ++++ +P G EY +A+ GG PI I ++ Sbjct: 213 HETVKVICKPCKPGQIQEYASEIARLSGGIPINTIGND 250 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,596,521 Number of Sequences: 37544 Number of extensions: 358456 Number of successful extensions: 856 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -