BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0889 (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) 28 6.5 SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_30064| Best HMM Match : SPC22 (HMM E-Value=5.5) 27 8.6 SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) 27 8.6 >SB_54941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = -1 Query: 355 PRRDPMHTARRRRPDNIEQNPHVPNLRDPCICADTRDILIKTKNSEIYLSVGLNRPIP 182 PR D T+ R ++ P +P++ PC A L K+ LSVGL +PIP Sbjct: 30 PRNDTA-TSMSRCDTTVQ--PLLPSISIPCGLAPNGHDLNKSSKKNTPLSVGLTQPIP 84 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.1 bits (62), Expect = 2.8 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 1/94 (1%) Frame = -1 Query: 541 SSALSPLVGPYFFETGSPSPLRYXSGLMLA-ASSEEFEDKSDDRSSIFTVSWLPSSR*KD 365 S + SP+ P+ SP P S SS D S + SS ++S+ PSS Sbjct: 532 SISTSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSPSSSSSP 591 Query: 364 SLLPRRDPMHTARRRRPDNIEQNPHVPNLRDPCI 263 S+ P + + R N +NP+ + P + Sbjct: 592 SVRPSPNLISNPNRNSNSNSNRNPNPSSNPSPSL 625 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 573 CSWAIPCQSADLLLFPLSLGHTFSKRA 493 C WA P ++ DLLL+ L + TF + A Sbjct: 294 CGWAFPQRNRDLLLYNLGILRTFRQFA 320 >SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) Length = 1301 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -2 Query: 504 SKRAPLLHCGTSPG*CWQRRLKNSKINRTIVLR--FSLCLGCPARGR 370 S +L C T+P W+ RL K R I+ F++ +G G+ Sbjct: 561 SDNCKILKCSTNPPILWKSRLSRQKKTRRIIAHVFFAVMIGATQLGQ 607 >SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = -1 Query: 586 KDRLLLLGYPLSKCRSSALSPLVGPYFFETGSPSPLRYXSGLMLAASSEEFEDKSD 419 +D+L LG+ C SS + + P ++ SP +R + + ++SE+F + D Sbjct: 598 RDQLFFLGFAQLWCSSSTKNSMHHPLLTDSHSPDRIRVHAAV---SNSEQFAEAYD 650 >SB_30064| Best HMM Match : SPC22 (HMM E-Value=5.5) Length = 197 Score = 27.5 bits (58), Expect = 8.6 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = -1 Query: 391 WLPSSR*KDSLLPRRDPMHTARRRRPDNIEQNPHVPNLRDPC---ICADTRDILIKTKNS 221 WL K + L RD A R R +++EQ + P C +R LI NS Sbjct: 12 WLHREDIKPTPLKYRDVWKHALRSRVESVEQRKGLRQANSPAYRHTCCLSRAHLIPIPNS 71 Query: 220 EIYLSV 203 +Y+ + Sbjct: 72 IVYIGI 77 >SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1514 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 182 RYGPVQSNREINLGVFSFY*NIPCICANARIT*IRNMRVLFDVIRSPPARGMHRI 346 +Y P+ +NR+I L S+ NI C + T + N+ V+ + ++PP I Sbjct: 1308 KYMPL-NNRKIKLAYTSYVVNIVLNCLFSPPTILLNIMVILAIYQTPPLHSASNI 1361 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,899,021 Number of Sequences: 59808 Number of extensions: 387702 Number of successful extensions: 870 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -