BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0889 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 28 0.26 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 4.2 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 7.3 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.9 bits (59), Expect = 0.26 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -2 Query: 438 NSKINRTIVLRFSLCLGCPARGRRTRCCLDAILCIPRAGGDRITSNRT 295 N++ R+ V R ++C+ C G + C++ I C + G + +RT Sbjct: 560 NARDCRSPVDRQNVCIRCGQEGHKAGTCMEEIRC-GKCDGPHVIGDRT 606 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -2 Query: 423 RTIVLRFSLCLGCPARGRRTRCCLDAILCIPRAGGDRI 310 R+ R +LC+ C G + R C + C G I Sbjct: 522 RSTADRQNLCIRCGLTGHKARSCQNEAKCALCGGAHHI 559 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -1 Query: 367 DSLLPRRDPMHTARRRRPDNIEQNPHVPNLRDPCICA 257 D +PRR P + A RR N + R C+ A Sbjct: 258 DGAMPRRKPPNGATSRRQPVYWWNASIKIQRAECVAA 294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,926 Number of Sequences: 2352 Number of extensions: 12930 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -