BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0889 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.2 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 3.9 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 3.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 5.1 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 21 6.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 6.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 317 SPPARGMHRIASRQQRVLLPRAGQPRHSEN 406 +PPA ++ QQ+ L P + QPR + N Sbjct: 1268 APPAYSCGTVSVPQQQQLPPSSPQPRLTVN 1297 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 95 NKIY*NS*INFAKCHEAKLPDI*FI 169 NKIY N AKC + PD+ F+ Sbjct: 124 NKIY-----NLAKCVQESAPDVWFV 143 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 95 NKIY*NS*INFAKCHEAKLPDI*FI 169 NKIY N AKC + PD+ F+ Sbjct: 124 NKIY-----NLAKCVQESAPDVWFV 143 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 131 LQNLFMSFSKSYSVVVIN 78 + +M+FSK YSV V++ Sbjct: 293 VNEFYMAFSKLYSVSVVS 310 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 216 ISEFLVFIKISRVSAQMQGSRRLGTCGFCSMLSGL 320 IS L+ I +S+ + +GTCG ++ GL Sbjct: 28 ISYALILFNILHMSSAEGWFKAIGTCGSHIIIVGL 62 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/39 (23%), Positives = 21/39 (53%) Frame = +3 Query: 81 NNHHRIRFTKTHK*ILQNATKPSYLTYSLYKKDAGMGRF 197 +N R+R+ +T ++ + + SYL L + D + ++ Sbjct: 275 HNDGRLRYWRTPSVVVSDYSDYSYLDEKLERNDLDLEKY 313 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,957 Number of Sequences: 438 Number of extensions: 3767 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -