BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0885 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 31 0.21 SPCC1682.04 |cdc31||centrin|Schizosaccharomyces pombe|chr 3|||Ma... 30 0.38 SPCC1827.07c ||SPCP1E11.01c|SPX/EXS domain protein|Schizosacchar... 28 1.1 SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosa... 28 1.1 SPBC32F12.05c |cwf12||complexed with Cdc5 protein Cwf12 |Schizos... 27 2.6 SPAC637.11 |suv3||ATP-dependent RNA helicase Suv3|Schizosaccharo... 27 2.6 SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr 2|... 26 6.1 SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pomb... 25 8.1 >SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 30.7 bits (66), Expect = 0.21 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 5/122 (4%) Frame = +2 Query: 101 LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIK--LDNWYQNELPKK--IKSRGKDAH 268 LE +K+FD Q+++ ++ ++ +EL K D ++ELP+K +S KD H Sbjct: 13 LEYRSKKFDKK----SQSLEEHEKKVQQKNEELEKKAADKISRDELPEKQLAQSNDKDKH 68 Query: 269 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKA-FRKLPNIESAMTALSNL 445 + + +K K+ +GK + L N P+ ET + F++ + S Sbjct: 69 SVSNPPHKTLKSKRQKGKNNDRKVILFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKT 128 Query: 446 KG 451 G Sbjct: 129 SG 130 >SPCC1682.04 |cdc31||centrin|Schizosaccharomyces pombe|chr 3|||Manual Length = 176 Score = 29.9 bits (64), Expect = 0.38 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = +2 Query: 224 NELPKKIKSRGKDAHMIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAV----MQETKK 391 +EL +++ G +A E++++++ GK Y Q+ ++V T + V ++E K+ Sbjct: 57 HELRAAMRALGFNAEK--SEVLKILRDFDKTGKGYLQMEDFVRVMTEKIVERDPLEEIKR 114 Query: 392 AFRKLPNIESAMTALSNLKGV 454 AF + E+ +L NL+ V Sbjct: 115 AFELFDDDETGKISLRNLRRV 135 >SPCC1827.07c ||SPCP1E11.01c|SPX/EXS domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 682 Score = 28.3 bits (60), Expect = 1.1 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 364 WRVHFYQIRQLRVEFSSGLFPFHELDKFFVDHV 266 WR+ Y I QL F SGL H D FF D + Sbjct: 401 WRMRRYLIIQLIRVFLSGLSTVHFQDFFFADQM 433 >SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 28.3 bits (60), Expect = 1.1 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +2 Query: 110 NAKEFD---SVLKLYPQAIKLKAERKTKRPDELIKLDNWYQNE-LP-KKIK 247 + ++FD +++ P A +KAERKTKRP + NE +P KK+K Sbjct: 88 SVEQFDFLQDIVEKVPDAPPIKAERKTKRPRARRAANEGEHNESVPAKKVK 138 >SPBC32F12.05c |cwf12||complexed with Cdc5 protein Cwf12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 27.1 bits (57), Expect = 2.6 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = +2 Query: 83 DTSTFFLEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNWYQNELPKKIKSRGKD 262 D + A+E V +L+ + ER+ K+ + +LD WY +P +S +D Sbjct: 103 DIDDYRYYGRARELPGVKELFEADMSFIPERQRKQEMQKRRLDAWYFGYIPPAQESLLED 162 Query: 263 AHMIHEE 283 EE Sbjct: 163 FEAKIEE 169 >SPAC637.11 |suv3||ATP-dependent RNA helicase Suv3|Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 27.1 bits (57), Expect = 2.6 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 65 TMATAKDTSTFFLEANAKEFDSVLKLYPQAIKLKAERKTKRPD---ELIKLDN---WY 220 ++A +K +STF L+ K D +L Y + ++ + + RPD +L L N WY Sbjct: 107 SLALSKSSSTFDLQKIKKIHDCLLSEYRKYVRYQERIEETRPDLQKQLTDLKNPIEWY 164 >SPBC1773.01 |||striatin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 25.8 bits (54), Expect = 6.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 115 CICLQKESRRVFRGSHCERSKCTTL 41 C+C+ K + +F G H +C +L Sbjct: 344 CVCVPKATHHIFSGGHDGTIRCWSL 368 >SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 25.4 bits (53), Expect = 8.1 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +2 Query: 224 NELPKKIKSRGKDAHMIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRK 403 +ELP+ I +G + E+L L QA + Y + + + ++ K F+K Sbjct: 3 SELPEVI-FKGTE---FEEQLSNLTSDSQANKRVYEDYDFKDETSAKPIPTEKKLKVFKK 58 Query: 404 LPNIESAMTAL 436 N+E+ ++AL Sbjct: 59 DDNVETLLSAL 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,061,326 Number of Sequences: 5004 Number of extensions: 64793 Number of successful extensions: 167 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -