BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0882 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15802.1 68417.m02405 expressed protein contains non-consensu... 46 2e-05 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 29 2.2 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 29 2.2 At5g60440.1 68418.m07581 MADS-box protein (AGL62) contains Pfal ... 29 2.2 At4g15233.1 68417.m02334 ABC transporter family protein similar ... 29 2.2 At1g62380.1 68414.m07038 1-aminocyclopropane-1-carboxylate oxida... 29 2.9 At5g37120.1 68418.m04455 hypothetical protein hypothetical prote... 29 3.8 At4g20810.1 68417.m03020 transcription initiation factor IIE (TF... 28 6.6 At3g52450.1 68416.m05768 U-box domain-containing protein similar... 28 6.6 At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containi... 27 8.8 At2g34730.1 68415.m04265 myosin heavy chain-related low similari... 27 8.8 At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein ... 27 8.8 At1g06590.1 68414.m00698 expressed protein 27 8.8 >At4g15802.1 68417.m02405 expressed protein contains non-consensus AT-AC splice sites at intron 4 Length = 50 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/34 (55%), Positives = 28/34 (82%) Frame = +1 Query: 133 EVTQYVQSLLQNMQDKFQSMSDQIINRIDEMGSR 234 ++T +VQ+LLQ MQ +FQ+MSD II +ID+MG + Sbjct: 15 DMTAFVQNLLQQMQTRFQTMSDSIITKIDDMGGQ 48 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 78 NNIVRVRFCHIKENKIYSNVNARTCR 1 NNIVR RF ++ K YS NAR R Sbjct: 303 NNIVRHRFVKSRDGKTYSESNARFVR 328 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 78 NNIVRVRFCHIKENKIYSNVNARTCR 1 NNIVR RF ++ K YS NAR R Sbjct: 303 NNIVRHRFVKSRDGKTYSESNARFVR 328 >At5g60440.1 68418.m07581 MADS-box protein (AGL62) contains Pfal profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain) Length = 299 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/70 (22%), Positives = 33/70 (47%) Frame = +1 Query: 43 FNMAEPNSDNIVKNTENEYSTPASDPKNMQEVTQYVQSLLQNMQDKFQSMSDQIINRIDE 222 F+ PN D+++ N P NMQ S++Q++ + Q++++++ Sbjct: 60 FSFGHPNVDSVIDRFINNNPLPPHQHNNMQLRETRRNSIVQDLNNHL----TQVLSQLET 115 Query: 223 MGSRVDELEK 252 + DEL+K Sbjct: 116 EKKKYDELKK 125 >At4g15233.1 68417.m02334 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1168 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/48 (25%), Positives = 28/48 (58%) Frame = +1 Query: 145 YVQSLLQNMQDKFQSMSDQIINRIDEMGSRVDELEKNITDLMTQAGVE 288 ++ L++++++ + +I RIDE+G + ++E +DL +A E Sbjct: 74 FIDDLIRHVENDNHVLLQKIRKRIDEVGIDLPKIEARFSDLFVEAECE 121 >At1g62380.1 68414.m07038 1-aminocyclopropane-1-carboxylate oxidase, putative / ACC oxidase, putative nearly identical to ACC oxidase (ACC ox1) GI:587086 from [Brassica oleracea] Length = 320 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = +1 Query: 133 EVTQYVQSLLQNMQDKFQSMSDQIINRIDEMGSRVDELEKNITDLMTQ 276 E T YV+ L Q+ + +SD+ + + G R++ L +++ DL+ + Sbjct: 90 ESTFYVRHLPQSNLNDISDVSDEYRTAMKDFGKRLENLAEDLLDLLCE 137 >At5g37120.1 68418.m04455 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 98 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 160 LQNMQDKFQSMSDQIINRIDEMGSRVDELEKNITDLMTQAGVENEK 297 L+N F+ + + +IN I+ + +R E+EK + +L T+ +E EK Sbjct: 3 LRNNNHIFKWVDEALINEIETLTARHGEIEKELKELRTER-LEFEK 47 >At4g20810.1 68417.m03020 transcription initiation factor IIE (TFIIE) alpha subunit family protein / general transcription factor TFIIE family protein contains Pfam profile: PF02002 TFIIE alpha subunit Length = 416 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +1 Query: 37 IFFNMAEPNSDNIV---KNTENEYSTPASDPKNMQEVTQYVQSLLQNMQDKFQSMSDQII 207 IFF+ N + ++ K T E SD N + +++ LLQNM+ + + + D I Sbjct: 147 IFFHCENCNGELVMECNKLTSEEVVVDGSD--NPRSRRDHLKDLLQNMEVRLKPLMDH-I 203 Query: 208 NRIDEM 225 NRI ++ Sbjct: 204 NRIKDL 209 >At3g52450.1 68416.m05768 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +1 Query: 70 NIVKNTENEYSTPAS--DPKNMQEVTQYVQSLLQNMQDKFQSMSDQIIN 210 NIV N+ + Y++P+S N+ ++ Q ++L+N D +S+ D+ ++ Sbjct: 144 NIVSNSVDTYNSPSSSLSSSNLNDMCQ--SNMLENRFDSSRSLMDEALS 190 >At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 763 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 378 LFIFIVDPDRLSWDDILTQIDR*KLFLLFI 289 +F +VDPD +SW+ IL+ D ++ L F+ Sbjct: 133 IFENLVDPDVVSWNTILSGFDDNQIALNFV 162 >At2g34730.1 68415.m04265 myosin heavy chain-related low similarity to SP|P14105 Myosin heavy chain, nonmuscle (Cellular myosin heavy chain) {Gallus gallus} Length = 825 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +1 Query: 133 EVTQYVQSLLQNMQDKFQSMSDQIINRIDEMGSRVDELEKNITDL 267 E TQ S L+NMQ + +S QI + + LEK DL Sbjct: 720 EKTQKTNSRLKNMQSQLSDLSHQINEVKGKASTYKQRLEKKCCDL 764 >At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 371 Score = 27.5 bits (58), Expect = 8.8 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 55 EPNSDNIVKNTENEYSTPASDPKNMQE-VTQYVQSLLQNMQDKFQSMSDQIINRIDEMGS 231 +P +D K + E T KN + V +YVQSL Q++Q K + + +E + Sbjct: 6 QPKADLAKKQKQVEDKTFGLKNKNKSKNVQKYVQSLKQSVQPKPDATKAAAKKKKEEEKA 65 Query: 232 RVDELEK 252 R EL + Sbjct: 66 REQELNE 72 >At1g06590.1 68414.m00698 expressed protein Length = 916 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = +1 Query: 106 PASDPKNMQEVTQYVQSLLQNMQDKFQSMSDQIINRIDEMGSRVDELEKNITDLMT 273 P S + Y+ SL ++ D F+ +++IN++ E+G +E++ +TD +T Sbjct: 38 PFSSVAQHNRLGLYLLSLTKSCDDIFEPKLEKLINQLREVG---EEMDAWLTDHLT 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,897,955 Number of Sequences: 28952 Number of extensions: 271318 Number of successful extensions: 765 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -