BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0879 (627 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-13|AAL00869.1| 187|Caenorhabditis elegans Hypothetical... 28 4.8 Z19153-1|CAA79546.1| 374|Caenorhabditis elegans Hypothetical pr... 27 8.3 >AC024817-13|AAL00869.1| 187|Caenorhabditis elegans Hypothetical protein Y54G2A.32 protein. Length = 187 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 521 NVDKNGRQSKSFTAVTAWMKRNWKS 595 NV+K +K+ TAV W+ +NWK+ Sbjct: 45 NVNKQTTIAKAKTAVKNWVPKNWKA 69 >Z19153-1|CAA79546.1| 374|Caenorhabditis elegans Hypothetical protein C38C10.1 protein. Length = 374 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 57 IFFKYLPTNISVFCA*CVVLFYVRKGKSVFNEILVQRKVMH 179 IF+ Y+ T + V A +++ G SV I+ Q KVMH Sbjct: 3 IFYLYVATQVFVAIAFVLLMATAIIGNSVVMWIIYQHKVMH 43 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,111,258 Number of Sequences: 27780 Number of extensions: 264606 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -