BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0879 (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5... 28 4.4 At4g01730.1 68417.m00224 zinc finger (DHHC type) family protein ... 27 7.7 >At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) / salicylic acid induction deficient 1 (SID1) identical to SP|Q945F0; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 543 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 75 PTNISVFCA*CVVLFYVRKGKSVFNEILVQRKVMHQTYLMCSCY 206 P IS+F F + S+ +L +VM QTY MC+ + Sbjct: 328 PVFISIFSKIAFYSFIIYCATSMGTHVLAAHQVMAQTYRMCNVW 371 >At4g01730.1 68417.m00224 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 499 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = +3 Query: 306 KALITNFVVRI*KRI--KVIQNFISRTYL 386 K +++ VVR +R+ K+++NF+ RTYL Sbjct: 85 KVVLSQVVVRFFRRLERKILRNFLRRTYL 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,774,842 Number of Sequences: 28952 Number of extensions: 220229 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -