BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0876 (788 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0455 - 19203028-19203186,19203485-19203859,19203981-192040... 29 5.6 09_06_0262 - 21921647-21922796,21922897-21923423 28 7.4 >12_02_0455 - 19203028-19203186,19203485-19203859,19203981-19204090, 19204200-19204243,19204435-19204635,19204937-19205079, 19205194-19205487,19205956-19206003 Length = 457 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 494 DTWNTIKRRDSHTILYHSFAW-GLPIATTSIGLSILYI 604 D W+T+K+ H ++Y +F + + IGL+IL++ Sbjct: 313 DQWHTLKQGVPHLVVYTAFFYFSISCFVIGIGLNILFL 350 >09_06_0262 - 21921647-21922796,21922897-21923423 Length = 558 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 487 IKKSPKPSCCIEILYPGRNNTTE*YTDIITRHGH 386 IK P P C + I + G E D+ RHGH Sbjct: 194 IKWCPGPGCTLAIEFVGGGGGEEKQDDVECRHGH 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,085,132 Number of Sequences: 37544 Number of extensions: 381490 Number of successful extensions: 765 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -