BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0875 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1861.06c |mug131||S. pombe specific UPF0300 family protein 4... 29 0.63 SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosacchar... 28 1.4 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 26 4.4 SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|... 26 5.8 SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces po... 25 7.7 >SPBC1861.06c |mug131||S. pombe specific UPF0300 family protein 4|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 29.1 bits (62), Expect = 0.63 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +1 Query: 85 LVNHFDIHCLLGS--WN--SGWHLHYCTSVHSVHRGVIWFSRFPII 210 LV+ DI+C+ GS W S H H VHSV I SR PII Sbjct: 258 LVHPEDIYCISGSSDWVCVSTQHFHCNIHVHSVSGNAIRKSRNPII 303 >SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosaccharomyces pombe|chr 3|||Manual Length = 478 Score = 27.9 bits (59), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 684 KNIKCII*VLYNFRGHAGDRP 622 KN+ C++ ++ N GHAG +P Sbjct: 121 KNMLCMVDIVVNHMGHAGSKP 141 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 200 FLLSVVQFPKYCAQAMMEGRGFN*FRHNF 286 FLL+ +Q+ + C ++ E R + F HNF Sbjct: 396 FLLADIQWQRVCYKSFRESRTWLHFLHNF 424 >SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 25.8 bits (54), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 684 KNIKCII*VLYNFRGHAGDRP 622 +N+ C+I ++ N HAGD P Sbjct: 126 RNMLCMIDIVVNHMAHAGDSP 146 >SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1057 Score = 25.4 bits (53), Expect = 7.7 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 620 NSNFNYICDSIVHIYKSH 567 NS +Y+CD++ +YKS+ Sbjct: 369 NSIIDYVCDALAALYKSN 386 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,846,399 Number of Sequences: 5004 Number of extensions: 61896 Number of successful extensions: 133 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -