Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0868
         (560 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z66524-7|CAA91419.2|  626|Caenorhabditis elegans Hypothetical pr...    27   7.0  

>Z66524-7|CAA91419.2|  626|Caenorhabditis elegans Hypothetical
           protein T13H5.3 protein.
          Length = 626

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 287 LRLI*ACTGGFENSVYLSLGSFKHSHMKDQVCRYHKIIYDFALTFQG-DLD 436
           L+L+ A  GG+ENS Y S+ +  HS     +  + K+I ++   F G D+D
Sbjct: 94  LKLLYA-VGGWENSQYFSVLTADHSRRSILISNFVKVIKEYG--FDGVDID 141


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,297,660
Number of Sequences: 27780
Number of extensions: 214858
Number of successful extensions: 346
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 346
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1155524042
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)