BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0861 (662 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0681 + 18628107-18629346,18630476-18630486,18630836-186309... 31 0.82 11_06_0640 + 25744048-25745021,25745128-25745273,25747870-257479... 29 2.5 01_05_0553 + 23185473-23186188,23187096-23187101,23187230-231873... 28 7.6 >04_03_0681 + 18628107-18629346,18630476-18630486,18630836-18630943, 18631158-18631250 Length = 483 Score = 31.1 bits (67), Expect = 0.82 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 593 E*SKVVVISPFSDSYHCSHSRFHTCILGSHTQTPTLERVWRDIPNKRFNSLYIHM 429 E +++ ISPFS H + C L H L+ +W P R N H+ Sbjct: 378 ENNRLEEISPFSQENCHLHRIYLQCDLSKHLMNKALDIIWGTSPEDRENDAQYHV 432 >11_06_0640 + 25744048-25745021,25745128-25745273,25747870-25747945, 25747996-25748230 Length = 476 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -3 Query: 264 LFISRSFCSNITDLQVYSGSILMNYSDTI 178 LF+++SFC+ + D VY G++L Y+D + Sbjct: 110 LFVTKSFCAIVVD--VYFGALLAYYADHV 136 >01_05_0553 + 23185473-23186188,23187096-23187101,23187230-23187374, 23187887-23188159,23188275-23188338,23188479-23188744, 23188951-23189045,23189544-23189718,23190669-23191063, 23191830-23191953,23192864-23192959,23193049-23193120, 23194687-23194824,23195369-23195549,23195602-23195963, 23196944-23197386,23197461-23197763,23197857-23198081, 23198260-23198350,23198702-23198779,23198939-23199229, 23199316-23199513,23199681-23200163,23200488-23200562, 23201163-23201324,23201400-23201729,23201816-23201916, 23202477-23202581,23202931-23203162,23203913-23204257, 23204346-23204447,23206010-23206153,23206463-23206551, 23206979-23207061,23207172-23207287,23207824-23207909, 23208461-23208560,23209270-23209335 Length = 2451 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = -1 Query: 635 NISVWSGRRVHGRQE*SKVVVISPFSDSYHCSHSRFHTCILGSHTQTPTLERVWRDIPNK 456 ++S+ R + GRQ K++ P + + SRF + + S+ P + +P+ Sbjct: 1449 SLSIDLRRELQGRQL-VKLLTTDPLNGGGPAAASRFLSTLRDSNDALPVAIGAMKLLPDL 1507 Query: 455 RFNSLYIHMFI 423 R L +H F+ Sbjct: 1508 RSKQLLVHFFL 1518 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,140,875 Number of Sequences: 37544 Number of extensions: 222455 Number of successful extensions: 468 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -