BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0861 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 1.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 26 1.2 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 2.8 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 6.5 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 6.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 6.5 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 6.5 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 6.5 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 6.5 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 280 QNNNKLIYFTFVL**HYRSSGIFRFYSNELFRYYFN*SLYRGAAN 146 QN++ ++Y+T+ + GI + SNEL Y N S ++N Sbjct: 1918 QNSSNVMYYTYNSVGKLKQRGIVKLSSNELSNYLPNDSDLPASSN 1962 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 280 QNNNKLIYFTFVL**HYRSSGIFRFYSNELFRYYFN*SLYRGAAN 146 QN++ ++Y+T+ + GI + SNEL Y N S ++N Sbjct: 1919 QNSSNVMYYTYNSVGKLKQRGIVKLSSNELSNYLPNDSDLPASSN 1963 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 578 VVISPFSDSYHCSHSRFHTCILGSHTQTPTLERVWRDIPNKRFNSL 441 V ++P S S H + L + +Q+PT +R W+ P +R N++ Sbjct: 375 VRVTPDSASSH-RRTGTERSFLYNGSQSPTGQRKWQTGPMRRVNTM 419 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 263 TTTDYTTAYPPTTNEPPSTPH 283 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 263 TTTDYTTAYPPTTNEPPSTPH 283 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 262 TTTDYTTAYPPTTNEPPSTPH 282 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 262 TTTDYTTAYPPTTNEPPSTPH 282 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 263 TTTDYTTAYPPTTNEPPSTPH 283 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 567 TNNDYFRSFLPAVNSPPA-PH 626 T DY ++ P N PP+ PH Sbjct: 263 TTTDYTTAYPPTTNEPPSTPH 283 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,080 Number of Sequences: 2352 Number of extensions: 9951 Number of successful extensions: 32 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -