BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0856 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1676 - 35302498-35302836,35302911-35302997,35303063-353032... 28 5.4 04_01_0601 + 7918220-7918559,7919082-7919158 28 7.2 >04_04_1676 - 35302498-35302836,35302911-35302997,35303063-35303286, 35303375-35303675,35303762-35303860,35304895-35305032, 35305108-35305326 Length = 468 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +1 Query: 445 EMWCCGN--GRCYEFHAYRTNASILRQL 522 E+W C + G+CY F AY+ +L+++ Sbjct: 135 EVWLCHSFGGKCYNFAAYQRAMDVLKEI 162 >04_01_0601 + 7918220-7918559,7919082-7919158 Length = 138 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = -1 Query: 204 AEA*PCSASAMNKTRSRRSMNSAAWIKSAMLILMVRGVNTAVTNDTRLHSNETINKSIQG 25 AE+ C + N++ +M S++ K+A ++ G+N + + L +N T + ++G Sbjct: 2 AESALCHTAKANRSVEHGTMRSSSTEKTASVVSPWMGLNLLLRLSSALIANRTREQLVEG 61 Query: 24 AQ 19 A+ Sbjct: 62 AR 63 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,980,415 Number of Sequences: 37544 Number of extensions: 331262 Number of successful extensions: 675 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -