BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0855 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 1.9 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 7.8 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.4 bits (53), Expect = 1.9 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 382 GALQYLAPVLMQKLTKQDDSDDELEWNPSKAASVCLMLLSNCCED 516 G ++Y+AP +++ D + L+ ++ L L+N CED Sbjct: 421 GTVRYMAPEVLEGAVNLRDCESALKQIDVYTLALVLWELANRCED 465 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 7.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 502 NCCEDEIVPHV 534 NCCE + +PHV Sbjct: 359 NCCEQQHLPHV 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,439 Number of Sequences: 2352 Number of extensions: 13799 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -