BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0853 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) 29 2.6 SB_56826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_51891| Best HMM Match : Sdh_cyt (HMM E-Value=7.7) 29 4.5 >SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) Length = 1624 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = -1 Query: 388 HIIKRLCTRRSRLHHDIPLLC*LKPNKGQKHILSRYTLNSTKRTSLLRI*FN 233 H ++ +CTRR H D + +K +KG++ ++ R + R ++ + N Sbjct: 513 HAMRSMCTRRRARHWDRLPIVGVKRDKGRRLVVPRPAIGGRTRQGIVNVNVN 564 >SB_56826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 519 ANTDPNKSSASQNLPPDRKHDPLRRSDEKL 608 A+T+P K SA QN+P HD +S+E+L Sbjct: 189 ADTEPIKQSAPQNIPAASSHD---KSEEEL 215 >SB_51891| Best HMM Match : Sdh_cyt (HMM E-Value=7.7) Length = 155 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 246 LRRLVRFVEFNVYRLRICF*PLLGF 320 +RR R +EF+V++LR+ F P++ F Sbjct: 13 IRRKCRTIEFSVWKLRVSFNPVVTF 37 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,157,667 Number of Sequences: 59808 Number of extensions: 319984 Number of successful extensions: 694 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -