BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0853 (670 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016674-3|AAB66128.1| 558|Caenorhabditis elegans Hypothetical ... 30 1.3 U53341-3|AAM69115.1| 608|Caenorhabditis elegans Hypothetical pr... 27 9.1 U53341-2|AAC69108.2| 645|Caenorhabditis elegans Hypothetical pr... 27 9.1 >AF016674-3|AAB66128.1| 558|Caenorhabditis elegans Hypothetical protein C03H5.5 protein. Length = 558 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -3 Query: 227 SKKFIDQSQPSLQG---LIKLHFIRGLLYCLIGCEITLVDRFVNVL 99 + + +DQ P +QG +I++ + G Y +IG VDRF+ VL Sbjct: 262 TSQILDQMPPEIQGTETMIRVTYQIGFAYLIIGRFAESVDRFLKVL 307 >U53341-3|AAM69115.1| 608|Caenorhabditis elegans Hypothetical protein F49E10.4b protein. Length = 608 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 55 SGFPLPSAPDLTTLSNTFTKRSTS 126 S PLP PD T N+ TK TS Sbjct: 380 SSLPLPDYPDATAYYNSATKEQTS 403 >U53341-2|AAC69108.2| 645|Caenorhabditis elegans Hypothetical protein F49E10.4a protein. Length = 645 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 55 SGFPLPSAPDLTTLSNTFTKRSTS 126 S PLP PD T N+ TK TS Sbjct: 425 SSLPLPDYPDATAYYNSATKEQTS 448 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,633,221 Number of Sequences: 27780 Number of extensions: 252674 Number of successful extensions: 533 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -