BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0853 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33390.1 68415.m04093 expressed protein 32 0.40 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 29 2.1 >At2g33390.1 68415.m04093 expressed protein Length = 98 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 536 QEQCFAESTTGSETRPTEKIRRETQWGCVYGVDSLVEPFV 655 + QC G +R T+KI+R QW + G D+L E V Sbjct: 38 ESQCLLPPRKGGMSRSTDKIKRTVQWNDIKG-DNLAEVLV 76 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -3 Query: 305 SEAYSQSIYIKFYKTNESSENMI*L*SKKFIDQSQPSLQGLIKLHFIRG 159 SEA + S+ +F T + S + KKF+D P+ + K+H+ RG Sbjct: 206 SEAGTSSLIPEFKLTIKKSHLLFLGIPKKFVDMHMPTETTMFKIHYPRG 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,832,097 Number of Sequences: 28952 Number of extensions: 233156 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -