BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0851 (583 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.9 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 22 3.8 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 3.8 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 6.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.9 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 582 GSGNDVLWATSTVYHSVYWVGYVISSGYDERVLMSC 475 G + +W V+ +V W+G+ I+SG + V+ +C Sbjct: 359 GFCSQCIWQEKIVFAAVTWLGW-INSGMNP-VIYAC 392 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 31 SRRANTSAVSPITLFGQPIPWV 96 ++ A T +SP L IPWV Sbjct: 69 AKGAFTGEISPAMLLDNGIPWV 90 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 522 GYVISSGYDERVLMSCRLLKMAQRC 448 GY +S +D +V+ + ++LKM C Sbjct: 210 GYTNNSKWDFKVIKATKVLKMYACC 234 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 6.7 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 516 VISSGYDERVLMSCRLLKMAQRCRL*ILTKRVELQVVVEIHIPKEPRR 373 ++ +G R+L +LL + + RL L + V V I + ++P R Sbjct: 198 ILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYIPLYQQPER 245 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 540 GKPSTSPKARH 572 GKP+ SP +RH Sbjct: 744 GKPTISPDSRH 754 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,935 Number of Sequences: 438 Number of extensions: 3325 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -