BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0850 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 0.96 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.9 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.2 bits (50), Expect = 0.96 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 369 HHFQECPQHEGDEIQCITSRACRC 440 HH P+ G +++ I AC C Sbjct: 464 HHHPHPPETPGPQVETILQNACFC 487 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 87 SPTDDVREQDGADLRQGSFLRLWT 158 SP +D + +D R+GS R W+ Sbjct: 194 SPPNDEGIETDSDRRKGSIARCWS 217 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 189 KSSHHGTKLYTWKERGLV*EDYPAYNPYDGTL 284 +S H+ +L W+ +V DY Y+ D L Sbjct: 272 ESDHNDGRLRYWRTPSVVVSDYSDYSYLDEKL 303 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 488 NVWLNLTPWCSV 523 N WL T WC V Sbjct: 110 NRWLFTTDWCDV 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,077 Number of Sequences: 438 Number of extensions: 3728 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -