BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0845 (637 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.05 |||GTPase activating protein |Schizosaccharomyces pom... 26 4.0 SPAC1851.02 |||1-acylglycerol-3-phosphate O-acyltransferase|Schi... 26 5.2 SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 26 5.2 >SPAC3G9.05 |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 659 Score = 26.2 bits (55), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 513 SGQVREPRSGPPPNVTRAIGLTP 581 SG ++E S PPN+TRA P Sbjct: 110 SGALKEVSSNTPPNMTRAASQPP 132 >SPAC1851.02 |||1-acylglycerol-3-phosphate O-acyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 279 Score = 25.8 bits (54), Expect = 5.2 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +1 Query: 1 VALHSRSLRTDYIK--AARARRSRSPQVRASVFHSLHQHYRDEPALLP 138 V RS R+D I+ A ARR R + VF + Y +P LLP Sbjct: 147 VVFIDRSRRSDAIQLFAKAARRMRKENISIWVFAEGTRSYSLKPCLLP 194 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 25.8 bits (54), Expect = 5.2 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = +2 Query: 395 FVKQRIA-----RGNIRYIWTSGRKCNFA 466 ++KQR++ G IR IW G+KC+ A Sbjct: 147 YLKQRVSFIGDVPGEIRCIWRKGKKCHSA 175 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,752,272 Number of Sequences: 5004 Number of extensions: 59398 Number of successful extensions: 165 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -