BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0845 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 27 0.50 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.5 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.5 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 27.1 bits (57), Expect = 0.50 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 270 ECSTPRASRYVEWRTRLAQLLGSGKARR 187 + + RASRYV W R+ +GS ++R+ Sbjct: 956 DAANERASRYVRWAHRVIPDVGSWQSRK 983 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.5 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = -2 Query: 555 RWVVGPILAPEPDQNQPFTFGGCRSPRSQPAKLHLRPEVQM*RMFPRAILCFTNSFSWGV 376 RW + P + F F RSP S + H+ E++ AI+ F N G Sbjct: 1426 RWSIQSTTGDIPASKRMFAFVAKRSPSSADNQCHVFCELEP-TQPAAAIIQFANKVLSGT 1484 Query: 375 SKETA 361 S++ A Sbjct: 1485 SQQPA 1489 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.5 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = -3 Query: 485 GHRGH-----SRRNYIYDQKSKCNVCFRERSFALQIRFPGVFLRKQRPCNACGRCSLRP 324 GH GH + R+ ++ K N RE + + V R + CNA GRC +P Sbjct: 362 GHGGHCIDCGANRDGPNCERCKENFFMREDGYCINCGCDPVGSRSLQ-CNAEGRCQCKP 419 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,849 Number of Sequences: 2352 Number of extensions: 17535 Number of successful extensions: 261 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 261 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -