BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0844 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 31 0.039 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 30.7 bits (66), Expect = 0.039 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Frame = +2 Query: 365 VTRKD-KHGNTALHLAVMLGRKECVQLLLAHSAPV--KVKNLAGWSP--LAEAISYGDRQ 529 V KD KHGN LH+AV + V +L + +N AG++P LA+A S+ + Sbjct: 877 VREKDLKHGNNILHIAVDNDALDIVHYILEEVKEELGRERNNAGYTPLQLADAKSHTGQG 936 Query: 530 TISTLVRKL 556 +VR+L Sbjct: 937 NNKLIVREL 945 Score = 27.5 bits (58), Expect = 0.37 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +2 Query: 392 TALHLAVMLGRKECVQLLLAHSAPVKVKNLAGWSPLAEAISYGDRQTISTLVRKLKQQAR 571 T LHLAV + V+ LL A + + G +PL A+ + + +VR L Q Sbjct: 786 TGLHLAVSCNSEPIVKALLGAGAKLHYCDYRGNTPLHRAVV----ENVPDMVRLLLLQGG 841 Query: 572 EQMEIRRPDLIRAL 613 +++ D + AL Sbjct: 842 LRLDCTNDDGLTAL 855 Score = 24.6 bits (51), Expect = 2.6 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 377 DKHGNTALHLAVMLGRKECVQLLLAHSA-PVKVKNLAGWSPLAEAISYGDRQTISTLVRK 553 D GNT LH AV+ + V+LLL + N G + L A+ Y I+ ++ + Sbjct: 814 DYRGNTPLHRAVVENVPDMVRLLLLQGGLRLDCTNDDGLTALQAAV-YARNLKITRILLE 872 Query: 554 LKQQAREQ 577 RE+ Sbjct: 873 AGASVREK 880 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,055 Number of Sequences: 2352 Number of extensions: 14115 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -