BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0844 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.79 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.79 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.2 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.4 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 9.8 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 9.8 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 9.8 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 287 KENYPLHECIFIGDVRKLSSLLRNNEVTRKDKH 385 KE YP + +FI + +S + E+T ++H Sbjct: 174 KETYPFNPVLFISSLENISLNGIDPELTESEQH 206 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 287 KENYPLHECIFIGDVRKLSSLLRNNEVTRKDKH 385 KE YP + +FI + +S + E+T ++H Sbjct: 212 KETYPFNPVLFISSLENISLNGIDPELTESEQH 244 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 486 PARFLTFTGALCANNNCTHSLRPNITARCKAVFPCLSLRV 367 P +T T C N CTH+ TA + P +RV Sbjct: 421 PNEIVTCTN--CGPNPCTHTTTNGCTAELRKKEPPHPIRV 458 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 486 PARFLTFTGALCANNNCTHSLRPNITARCKAVFPCLSLRV 367 P +T T C N CTH+ TA + P +RV Sbjct: 407 PNEIVTCTN--CGPNPCTHTTTNGCTAELRKKEPPHPIRV 444 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 486 PARFLTFTGALCANNNCTHSLRPNITARCKAVFPCLSLRV 367 P +T T C N CTH+ TA + P +RV Sbjct: 441 PNEIVTCTN--CGPNPCTHTTTNGCTAELRKKEPPHPIRV 478 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 486 PARFLTFTGALCANNNCTHSLRPNITARCKAVFPCLSLRV 367 P +T T C N CTH+ TA + P +RV Sbjct: 390 PNEIVTCTN--CGPNPCTHTTTNGCTAELRKKEPPHPIRV 427 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 240 CCNLHALCPTLIIVKARKTILYT-NVFLSGTYASYL 344 CC+ L T I RKT+ YT N+ + S+L Sbjct: 226 CCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.2 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 240 CCNLHALCPTLIIVKARKTILYT-NVFLSGTYASYL 344 CC+ L T I RKT+ YT N+ + S+L Sbjct: 226 CCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 534 YPLWYVNSSNRLENK 578 Y WY+N LENK Sbjct: 205 YSGWYLNHDYNLENK 219 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 534 YPLWYVNSSNRLENK 578 Y WY+N LENK Sbjct: 205 YSGWYLNHDYNLENK 219 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 5.6 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 16 FSFIYSKCLSGRRVNYIFW 72 F F+++ L VNY +W Sbjct: 312 FVFVFAALLEYAAVNYTYW 330 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 240 CCNLHALCPTLIIVKARKTILYT 308 CC+ L T I RKT+ YT Sbjct: 222 CCDEPYLDITFNITMRRKTLFYT 244 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 240 CCNLHALCPTLI 275 CC H +CP ++ Sbjct: 58 CCRTHDMCPDVM 69 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 240 CCNLHALCPTLI 275 CC H +CP ++ Sbjct: 63 CCRTHDMCPDVM 74 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 240 CCNLHALCPTLI 275 CC H +CP ++ Sbjct: 63 CCRTHDMCPDVM 74 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,418 Number of Sequences: 438 Number of extensions: 3904 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -