BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0843 (778 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 25 1.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.7 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 426 IMVYVPYIYSYACRKKRLFQHYKQTLQFYLY 334 + V+ P Y + L+Q Y+Q+L Y Y Sbjct: 427 VAVHDPVFYQLYKKVMNLYQQYQQSLPVYQY 457 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 735 ESRDLGXPYDSSGNL 691 +S+D G P D +GN+ Sbjct: 350 QSKDQGPPNDGNGNI 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,880 Number of Sequences: 438 Number of extensions: 4074 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -