BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0842 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0144 - 1705429-1706250 29 1.8 05_05_0059 + 22011168-22011662,22012668-22012894,22013029-220133... 29 3.1 04_04_0751 - 27769616-27769684,27769795-27769917,27769998-277707... 28 4.1 09_01_0060 - 942762-943448,943840-943867,944044-944077,944383-94... 27 7.2 06_01_0734 + 5419951-5420475 27 7.2 04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035,807... 27 7.2 10_02_0172 - 6162692-6163066 27 9.5 06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 27 9.5 04_04_1191 + 31599067-31600194 27 9.5 02_01_0171 - 1179095-1179388,1179668-1179801,1180036-1180900,118... 27 9.5 01_06_0004 + 25507739-25508206,25509346-25509477,25509910-255100... 27 9.5 01_03_0220 - 13905808-13905831,13906694-13906885,13906960-139075... 27 9.5 01_01_0132 - 1197988-1198206,1198255-1198356,1198518-1198821,119... 27 9.5 >10_01_0144 - 1705429-1706250 Length = 273 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -1 Query: 255 WMNSTPVAAGAMVKTRCWYHLEQFLRALP 169 W+ +TP+A CWY L L +P Sbjct: 241 WLRTTPLALAPPSSAPCWYFLTTLLEIIP 269 >05_05_0059 + 22011168-22011662,22012668-22012894,22013029-22013377, 22013464-22013508,22013589-22013735,22013851-22013988, 22014126-22014159,22014258-22014430 Length = 535 Score = 28.7 bits (61), Expect = 3.1 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 452 WTSAMPGAEPSRCLPLNTLHKPRLKKDMS*RSGNTVEGSSFHS-RMVRGKKDLWKRTVDD 276 W S S L T+ K L+ ++ RS + ++GS F S R + K ++W V + Sbjct: 293 WLSVWLFNVESDPLDSRTISKSELQLILAGRSASKIQGSKFPSLREILSKIEMWAIIVAN 352 Query: 275 RSGSR*YG*TLLRWRPV 225 + Y LL W PV Sbjct: 353 VVNNWGYF-VLLSWMPV 368 >04_04_0751 - 27769616-27769684,27769795-27769917,27769998-27770770, 27771407-27771773,27772104-27772217,27772307-27772403, 27772968-27773088,27773168-27773252,27773349-27773498, 27773630-27773746,27773819-27773905,27773981-27774049, 27774125-27774181,27774266-27774349,27774477-27774513, 27774721-27774869,27776053-27776538,27776743-27776886, 27776961-27777509,27778332-27778526,27779226-27779310, 27779570-27779670,27779689-27780360,27781101-27781433, 27781957-27782038,27782258-27782334,27782713-27782817, 27783810-27783944,27784437-27785159,27785882-27786663, 27787480-27789187 Length = 2891 Score = 28.3 bits (60), Expect = 4.1 Identities = 29/84 (34%), Positives = 34/84 (40%), Gaps = 5/84 (5%) Frame = +2 Query: 275 GHPQCVSRDLFCHVPSGYGMSSPPRCFPSAMTCPSSNEACGEY*AVGSGLA-----LPLA 439 G C SR L VPS +SS S C S NE + S L+ LPL Sbjct: 1258 GQHFCTSRSLDSAVPSASMVSSAAS--RSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLD 1315 Query: 440 LLKSMGDGNHSPSGGPYARLPTKA 511 +L SM D N S RL + A Sbjct: 1316 VLTSMADSNGQISAAVMERLTSAA 1339 >09_01_0060 - 942762-943448,943840-943867,944044-944077,944383-944437 Length = 267 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 298 SGNALWMTAVAPGSMDELYSGGGRCDGKNEMLVSSRTIPQSTPHGT 161 +G+ALW T V G GGG G +L +S + P GT Sbjct: 159 TGHALWSTNVTAGVNSSASGGGG---GAMAVLANSSNLVLRLPDGT 201 >06_01_0734 + 5419951-5420475 Length = 174 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 377 SSNEACGEY*AVGSGLALPLALLKSMGDGNHSPSG 481 S+ A + G GL LA L MGDG SP G Sbjct: 96 SAAAAAADRRGAGGGLMYLLAQLMGMGDGGGSPYG 130 >04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035, 8078108-8078360,8078613-8078768,8078854-8079770, 8079858-8079927,8082310-8082416,8082722-8082755, 8083621-8083940,8084031-8084820,8084890-8085046, 8085647-8086068 Length = 1255 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 284 QCVSRDLFCHVPSGYGMSSPPRCFPSAMTCP 376 QCV++D + SPPRC PS+ +CP Sbjct: 107 QCVAKDAAAQPEMSWPRGSPPRC-PSS-SCP 135 >10_02_0172 - 6162692-6163066 Length = 124 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +1 Query: 361 RYDMSFFKRGLWR---VLSGRQRLGSAPGIA---EVHGRR*PLTIRWAVCPSAYKG 510 R+D+ F +G WR + RL A A V RR L WA C S Y G Sbjct: 9 RFDLVFEMKGRWRREGAAAMAMRLNEAVWHATGGSVWRRRQELAFLWADCESGYDG 64 >06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 Length = 478 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 413 GSGLALPLALLKSMGDGNHSPSGGPYARL 499 GS LA L LL M PSG YARL Sbjct: 64 GSDLASSLRLLADMQAAGLRPSGAAYARL 92 >04_04_1191 + 31599067-31600194 Length = 375 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -1 Query: 135 EVPPQTQRLHTYY*SNLTESIS---LTRLPTIGSLV 37 +VPP L T+ +NLT+ + L+ LPTI +LV Sbjct: 132 QVPPPPPSLDTFLITNLTDKVQSRLLSFLPTITNLV 167 >02_01_0171 - 1179095-1179388,1179668-1179801,1180036-1180900, 1180998-1181258,1181424-1181621,1181752-1181982, 1185337-1185648,1185750-1186247 Length = 930 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 331 NELPSTVFPERYDMSFFKRGLWRVLSG 411 N+ T + RY+M+F K G W++ G Sbjct: 899 NDSYDTKYTTRYEMAFSKLGGWKITEG 925 >01_06_0004 + 25507739-25508206,25509346-25509477,25509910-25510086, 25510175-25510219,25510305-25510512,25510766-25510825, 25510826-25511016,25511219-25511614 Length = 558 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = +2 Query: 320 SGYGMSSPPRCFPSAMTCPSSNEACGEY*AVGSGLALPLALLKSMGDGNHSPS 478 +G G SP + PS PS N GSG A P + S G GN PS Sbjct: 79 NGKGYQSPYQPSPS----PSPNAPVSPSPVNGSGHASPKSPTPSCGKGNQPPS 127 >01_03_0220 - 13905808-13905831,13906694-13906885,13906960-13907519, 13910007-13910187 Length = 318 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +2 Query: 365 MTCPSSNEACGEY*AVGSGLALPLALLKSMGDGNHSPSGGPYARLPTKAIKKKT 526 +T S+ CGE+ G+ L++ +L+ S + +G P++R PT KT Sbjct: 262 VTIFSAPNYCGEFDNAGALLSIDESLMCSFQILKPNDTGAPHSRKPTSNKTPKT 315 >01_01_0132 - 1197988-1198206,1198255-1198356,1198518-1198821, 1199221-1199292,1199384-1199420,1199527-1199585, 1199844-1200128,1200293-1200465,1201020-1201213, 1202245-1202374 Length = 524 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 440 LLKSMGDGNHSPSGGPYARLPTKAIKKKTR 529 LLK M D P+ GP A+ P +++TR Sbjct: 55 LLKGMPDSAAGPAEGPIAKYPLVLAEERTR 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,030,033 Number of Sequences: 37544 Number of extensions: 457837 Number of successful extensions: 1184 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1184 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -