BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0839 (373 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 229 7e-61 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 227 2e-60 SB_56| Best HMM Match : Actin (HMM E-Value=0) 227 2e-60 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 227 2e-60 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 226 4e-60 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 225 7e-60 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 205 8e-54 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 7e-21 SB_54| Best HMM Match : Actin (HMM E-Value=0) 87 3e-18 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 64 3e-11 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 64 5e-11 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.002 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.008 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.17 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 0.69 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 29 1.6 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 1.6 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) 27 3.7 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 27 3.7 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 27 3.7 SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.7 SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.7 SB_22697| Best HMM Match : Hirudin (HMM E-Value=3.2) 27 3.7 SB_34205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) 27 4.9 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 27 4.9 SB_45827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) 27 6.4 SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_77| Best HMM Match : cNMP_binding (HMM E-Value=0.0097) 27 6.4 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 27 6.4 SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) 27 6.4 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) 26 8.5 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 26 8.5 SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) 26 8.5 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_28474| Best HMM Match : GSH_synthase (HMM E-Value=3.20001e-40) 26 8.5 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 229 bits (559), Expect = 7e-61 Identities = 106/111 (95%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 199 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 258 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSIL Sbjct: 259 NTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSIL 309 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 227 bits (556), Expect = 2e-60 Identities = 105/111 (94%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSIL Sbjct: 297 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSIL 347 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 227 bits (556), Expect = 2e-60 Identities = 105/111 (94%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSIL Sbjct: 296 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSIL 346 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 227 bits (555), Expect = 2e-60 Identities = 105/111 (94%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSIL Sbjct: 297 NTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSIL 347 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 226 bits (553), Expect = 4e-60 Identities = 104/111 (93%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 +EKSYELPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 210 IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYA 269 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSIL Sbjct: 270 NTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSIL 320 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 225 bits (551), Expect = 7e-60 Identities = 104/111 (93%), Positives = 109/111 (98%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 NTVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSIL Sbjct: 296 NTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSIL 346 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 205 bits (501), Expect = 8e-54 Identities = 93/113 (82%), Positives = 104/113 (92%) Frame = -3 Query: 341 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 162 P LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDL Sbjct: 8 PILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDL 67 Query: 161 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 3 Y+N VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSIL Sbjct: 68 YSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSIL 120 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 96.3 bits (229), Expect = 7e-21 Identities = 40/85 (47%), Positives = 57/85 (67%) Frame = -3 Query: 335 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 156 L + Y LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299 Query: 155 NTVLSGGTTMYPGIADRMQKEITAL 81 + VLSGG+TMYPG+ R+++EI L Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQL 324 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 87.4 bits (207), Expect = 3e-18 Identities = 41/73 (56%), Positives = 49/73 (67%) Frame = -3 Query: 356 ELGTGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVD 177 E T E Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D Sbjct: 2274 EAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDID 2333 Query: 176 IRKDLYANTVLSG 138 +R +L+ N VLSG Sbjct: 2334 LRAELFHNIVLSG 2346 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 64.1 bits (149), Expect = 3e-11 Identities = 27/82 (32%), Positives = 51/82 (62%), Gaps = 3/82 (3%) Frame = -3 Query: 239 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 60 G A G+ + S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 59 KII---APPERKYSVWIGGSIL 3 K+I + E++++ WIGGSIL Sbjct: 206 KLISNNSSVEKRFNPWIGGSIL 227 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 63.7 bits (148), Expect = 5e-11 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 17/116 (14%) Frame = -3 Query: 299 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 123 + + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 122 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSIL 3 R+Q++I + P ++ ++I+ ++Y+VW GGS+L Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSML 311 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 46.0 bits (104), Expect = 1e-05 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 9/75 (12%) Frame = -3 Query: 203 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 48 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 47 PP-ERKYSVWIGGSI 6 PP + W+GG+I Sbjct: 124 PPVNANITAWLGGAI 138 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -3 Query: 200 SIMKCDVDIRKDLYANTVLSGGTTMYPG 117 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 36.3 bits (80), Expect = 0.008 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 347 TGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFL 240 T L K Y LPDGQ+I+IG E E LF+P L Sbjct: 863 TNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.17 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 269 PEALFQPSFLGMEACGIHET 210 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 0.69 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 7 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 180 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 181 TS 186 S Sbjct: 815 AS 816 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 28.7 bits (61), Expect = 1.6 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 333 REVLRTSRRSGHHYRKRKIPLPR--GSLPTLVLGYGSLRHPR 214 R++LR R HHYR+ + R G++P + Y + R PR Sbjct: 521 RDLLRALRNKKHHYRELPDEVKRSLGTIPDEYVRYFTSRFPR 562 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 28.7 bits (61), Expect = 1.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 2.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 155 NTVLSGGTTMYPGIADRMQKEITALAP 75 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 329 Score = 27.5 bits (58), Expect = 3.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 336 PREVLRTSRRSGHHYRKRKIPLPRGSLP 253 PR ++R HY++ +PLPRG P Sbjct: 133 PRGGSPLTKRRESHYQEEGVPLPRGGSP 160 Score = 26.6 bits (56), Expect = 6.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 336 PREVLRTSRRSGHHYRKRKIPLPRGSLP 253 PR ++R HY++ +PLPRG P Sbjct: 155 PRGGSPLTKRRESHYQEEGVPLPRGGGP 182 Score = 26.6 bits (56), Expect = 6.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 315 SRRSGHHYRKRKIPLPRGSLP 253 ++R HY++ +PLPRG P Sbjct: 265 TKRRESHYQQEGVPLPRGGSP 285 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 27.5 bits (58), Expect = 3.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ SETK SV +R + + W+W+ Sbjct: 457 STKSETKASVVERFNRTFKGWMWR 480 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 27.5 bits (58), Expect = 3.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ SETK SV +R + + W+W+ Sbjct: 93 STKSETKASVVERFNRTFKGWMWR 116 >SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 27.5 bits (58), Expect = 3.7 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ SE K SV +R + ++W+W+ Sbjct: 193 STRSELKSSVVERFNRTLKTWIWR 216 >SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.5 bits (58), Expect = 3.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ SETK SV +R + + W+W+ Sbjct: 439 STKSETKASVVERFNRTFKGWMWR 462 >SB_22697| Best HMM Match : Hirudin (HMM E-Value=3.2) Length = 306 Score = 27.5 bits (58), Expect = 3.7 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Frame = -2 Query: 198 HHEVRRGHP*GLVRQHRIVRWYHHVPWNRRPYAKGNHSSRPIDNED*DHCS-SREEVLRM 22 ++EV G+P H + YH VP A G H P + H S S VLR Sbjct: 205 YYEVPHGYPAAPHGYHEVPHGYHAVPHGYYEVAHGYHEV-PHGYHEVPHGSRSASWVLRS 263 Query: 21 DRWI 10 W+ Sbjct: 264 GSWV 267 >SB_34205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 759 Score = 27.1 bits (57), Expect = 4.9 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = -3 Query: 230 ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIA 111 A H+ T + + + + +Y N ++ GT+ +PG++ Sbjct: 636 ALNFHDETGDILQSVTLKVGHVIYGNVLIPSGTSSFPGLS 675 >SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) Length = 368 Score = 27.1 bits (57), Expect = 4.9 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -1 Query: 370 THYRANWVPGPPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRS 242 T YR WV G +L NF L D VA + R+ Sbjct: 182 TRYRTAWVSGAAFSALANFSAEDFELQHLPDEVALPIKDRLRA 224 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 27.1 bits (57), Expect = 4.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 113 RFQGTWWYHRTIRCWRTSPYGCPRR 187 RF+ WY R C R YGCP R Sbjct: 1613 RFRPQAWYSRV--CLRAEVYGCPDR 1635 >SB_45827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2047 Score = 26.6 bits (56), Expect = 6.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 363 IGRIGYRAPPREVLRTSRRSGHHYRKR 283 + I Y RE + S R GHH+R R Sbjct: 817 VSTISYSGTAREPVPVSGRGGHHFRCR 843 >SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) Length = 291 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK--LAASTRPHITP 197 S+ SE K SV +R + ++W+W+ TR ++ P Sbjct: 226 STQSELKASVVERFNRTLKTWMWRWFTHKETRRYVLP 262 >SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +1 Query: 133 VPPDNTVLAYKSLRMSTSHFMMELYVVSWMPQASIPKNEGWKRASGQ 273 +PP N L++ R + ++ + M +P+N GW+ +GQ Sbjct: 560 LPPTNDSLSHHIKRANYQAYIWRSSTTA-MQNLPLPENNGWRNNAGQ 605 >SB_77| Best HMM Match : cNMP_binding (HMM E-Value=0.0097) Length = 498 Score = 26.6 bits (56), Expect = 6.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 15 TDPYGVLPLWRSNDLNLHCRWGESCD 92 T P+ P+ R N L RW +CD Sbjct: 265 TSPHRKQPIGRCNSLTYMSRWAAACD 290 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 26.6 bits (56), Expect = 6.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 155 WRTSPYGCPRRTS 193 W SPY CPRR S Sbjct: 1115 WMCSPYNCPRRRS 1127 >SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) Length = 564 Score = 26.6 bits (56), Expect = 6.4 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = -1 Query: 373 TTHYRANWVPGPPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAASTRPHITPS 194 T H R++W+ P S + SSL+ T R + + RS W AS TP Sbjct: 183 TNHGRSSWLTNAPHPSRYTSNGLSSSLANTPH--PSRYTPHGRS-SWLANASHPSRYTPH 239 Query: 193 *SATWTS 173 ++W S Sbjct: 240 GRSSWIS 246 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 26.6 bits (56), Expect = 6.4 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 373 TTHYRANW--VPGPPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSW 239 TTHYRANW + L + P R+S++ K++V Q + R W Sbjct: 73 TTHYRANWSSTAVAAALELVDPPGCRNSIA-GKNTVTQVGITLSRKW 118 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) Length = 203 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 297 HYRKRKIPLPRGSLPTLVLGYGSLRHPRDH 208 H+RKR LPR ++ + G GS PRD+ Sbjct: 58 HHRKRSRSLPRTNVFGTLNGLGSPPPPRDN 87 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 26.2 bits (55), Expect = 8.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ +ETK SV +R + + W+W+ Sbjct: 100 STKNETKASVVERFNRTFKGWMWR 123 >SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1847 Score = 26.2 bits (55), Expect = 8.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 301 SSLSETKDSVAQRLSSNPRSWVWK 230 S+ +ETK SV +R + + W+W+ Sbjct: 902 STKNETKASVVERFNRTFKGWMWR 925 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_28474| Best HMM Match : GSH_synthase (HMM E-Value=3.20001e-40) Length = 372 Score = 26.2 bits (55), Expect = 8.5 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -2 Query: 297 HYRKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEV 187 H RK +IPL R SL + +L G LR + I HEV Sbjct: 255 HQRKPRIPLFRRSL-SAILKNGELREDKKLILEGHEV 290 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 20 VPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 349 VPGPPSRSLTNFPTVRSSLSETKDSVAQR 263 VPGPPSRS + + +S S V +R Sbjct: 18 VPGPPSRSTVSISLISNSCSPGDPLVLER 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,997,154 Number of Sequences: 59808 Number of extensions: 318580 Number of successful extensions: 1036 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 607387585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -