BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0836 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66850.1 68418.m08428 protein kinase family protein contains ... 32 0.45 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 30 1.4 At1g06360.1 68414.m00672 fatty acid desaturase family protein si... 29 3.2 At5g56270.1 68418.m07022 WRKY family transcription factor 29 4.2 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 28 5.5 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 28 5.5 At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapie... 28 7.3 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 7.3 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 7.3 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 27 9.6 At2g40040.1 68415.m04920 defective chloroplasts and leaves prote... 27 9.6 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 9.6 At2g26670.1 68415.m03199 heme oxygenase 1 (HO1) (HY1) identical ... 27 9.6 >At5g66850.1 68418.m08428 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain; identical to cDNA MAP3K gamma protein kinase GI:2315152 Length = 716 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/54 (35%), Positives = 24/54 (44%) Frame = +1 Query: 235 PQNRNCR*ESSCSLPRRKAHPLPGRKENPLPRESARSPTLPRCQTCPLPS*RDC 396 PQ R+ R + P R + PL + PR+S SP PR T RDC Sbjct: 253 PQPRSPRKQIRSPQPSRPSSPLHSVDSSAPPRDSVSSPLHPRLSTDVTNGRRDC 306 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 30.3 bits (65), Expect = 1.4 Identities = 27/77 (35%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Frame = +1 Query: 277 PRRKAHPLPGRKENPLPRES----ARSPTLPRCQTCPLPS*RDCQGTSSRTATLPSRKEG 444 PRR L R+ +PLPR RSP P + P R R PSR G Sbjct: 212 PRRPRERLSPRRRSPLPRRGLSPRRRSPDSPHRRRPGSPIRRRGDTPPRRRPASPSR--G 269 Query: 445 ALPSTCPSRQTR-PRQG 492 PS+ P R+ R P +G Sbjct: 270 RSPSSPPPRRYRSPPRG 286 >At1g06360.1 68414.m00672 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 670 HMDLYWYLYLFVYGGKEQGTCTGNLYGVRYFLLYWVRSGHVH 545 H+ ++W + L++YGG TC G + GV + + W+ + H Sbjct: 177 HVLMFWTV-LYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACH 217 >At5g56270.1 68418.m07022 WRKY family transcription factor Length = 687 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 599 PLRGKVLSSLLGKERARALRLEHELSFQRGKVL 501 P G + SS +G+E++ LE ELS G+V+ Sbjct: 19 PSPGTLFSSAIGEEKSSKRVLERELSLNHGQVI 51 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 274 LPRRKAHPLPGRKENPLPRESARSPTLP 357 +P K P+P K P+P S SP++P Sbjct: 39 VPSPKPKPVPSPKPKPVPSPSVPSPSVP 66 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 28.3 bits (60), Expect = 5.5 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 355 VGLGNVHFHGVGDFLFYRVGDVLFDGVGN 269 VG+G+V GVGD VGDV DGVG+ Sbjct: 194 VGVGDVGQGGVGDVGQGGVGDVGRDGVGD 222 >At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapiens, PIR:S53363 Length = 438 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 411 TYRNPTQSKRRCLTQYMSQSTDPSPSRYMCQNLTPLKRK 527 T R+ + K+ TQ + ++ SP R + ++LTP RK Sbjct: 127 TIRSSSVPKKTTTTQIQASASVSSPKRTVSRSLTPSSRK 165 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 295 PLPGRKENPLPRESARSPTLPRCQT---CPLPS*RDCQGTSSRTATLPSRKEGALPSTCP 465 P +P PR +RSP+ R ++ PLPS Q S++ + PS + + + P Sbjct: 245 PAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPS---VQKEGSKSPSKPSPAKSPIHTRSP 301 Query: 466 SR 471 SR Sbjct: 302 SR 303 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 295 PLPGRKENPLPRESARSPTLPRCQT---CPLPS*RDCQGTSSRTATLPSRKEGALPSTCP 465 P +P PR +RSP+ R ++ PLPS Q S++ + PS + + + P Sbjct: 245 PAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPS---VQKEGSKSPSKPSPAKSPIHTRSP 301 Query: 466 SR 471 SR Sbjct: 302 SR 303 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 603 PVHVPCSLPPYTKRYKYQ*RSMWDRPYPVHIPKPVPYPVEKP 728 PV+ P P Y+ + P P ++PKP P KP Sbjct: 138 PVYTPPVYKPTPSPPVYKKSPSYSSPPPPYVPKPTYTPTTKP 179 >At2g40040.1 68415.m04920 defective chloroplasts and leaves protein-related / DCL protein-related similar to DCL protein, chloroplast precursor (Defective chloroplasts and leaves protein) (Swiss-Prot:Q42463) [Lycopersicon esculentum] Length = 839 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +3 Query: 345 PNPTPLSNMSLTQLKRLSRYQFTYRNPTQSKRRCLTQYMSQSTDPSPSRYMCQN 506 P+ + S TQ + S+ Q ++ +QS+ + +Q SQS SPS+ Q+ Sbjct: 765 PSQAQAQSPSQTQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSPSQTQTQS 818 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 9.6 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +1 Query: 280 RRKAHPLPGRKENPLPRESARSPTLP-RCQTCPLPS*RDCQGTSSRTATLPSRKEGALPS 456 RR H GR+++P P RSP+ P R + P P R R+ + P+R+ + Sbjct: 293 RRPTHE--GRRQSPAPSRRRRSPSPPARRRRSPSPPAR-----RRRSPSPPARRHRS--P 343 Query: 457 TCPSRQTR 480 T P+RQ R Sbjct: 344 TPPARQRR 351 >At2g26670.1 68415.m03199 heme oxygenase 1 (HO1) (HY1) identical to plastid heme oxygenase (HY1) [Arabidopsis thaliana] GI:4877362, heme oxygenase 1 [Arabidopsis thaliana] GI:4530591 GB:AF132475; annotation updated per Seth J. Davis at University of Wisconsin-Madison Length = 282 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 363 SNMSLTQLKRLSRYQFTYRNPTQSKRRCLTQYMSQSTDPSPS 488 S++S+ + +LSR+QF+ +P R Q +S + + SPS Sbjct: 9 SSLSIFKNPQLSRFQFSSSSPNPLFLRPRIQILSMTMNKSPS 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,574,541 Number of Sequences: 28952 Number of extensions: 278755 Number of successful extensions: 955 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -