Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0834
         (741 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    28   0.35 
AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       23   7.5  

>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 27.9 bits (59), Expect = 0.35
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = -2

Query: 380 IEFFTRI-VSLGNCWEA*THTKNKKTAISSI--FSKQLTLECNWK 255
           +E F R+ V+LGN     T  +NK+T+I  I   S  L+   NW+
Sbjct: 139 LESFARLGVTLGNAGTTPTFNRNKRTSIVDITFCSTTLSERLNWR 183


>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 23.4 bits (48), Expect = 7.5
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 473 TLSQTCYVCAYN 438
           TLS+ CY C YN
Sbjct: 313 TLSKACYNCPYN 324


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 782,091
Number of Sequences: 2352
Number of extensions: 15882
Number of successful extensions: 53
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76091949
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)