BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0834 (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.7 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.0 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.3 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 469 NVITIYETMLIYSFE*IFFPYVILGRLRGYSNYGR 573 NV+ + +L Y E I+F ++LG L S+ R Sbjct: 443 NVLGVQGALLSYFIEPIYFHSIVLGSLLNPSHMYR 477 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 308 TAISSIFSKQLTLECNWKGFCLLPRLQKV 222 T ++I S + CN+K +CL L + Sbjct: 129 TTSTTIVSGAMAERCNFKAYCLFSFLNTI 157 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 136 AQHNRRSEWTYLYINKK*HQIHSYLS 59 A+ NR+ W Y Y K H I +S Sbjct: 429 AKVNRQPVWFYYYTYKGAHSISEIMS 454 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 136 AQHNRRSEWTYLYINKK*HQIHSYLS 59 A+ NR+ W Y Y K H I +S Sbjct: 429 AKVNRQPVWFYYYTYKGAHSISEIMS 454 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,760 Number of Sequences: 438 Number of extensions: 4674 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -